« Back
Home /
Recombinant Human Annexin A2(ANXA2)

Recombinant Human Annexin A2(ANXA2)

Item no.	CSB-RP010654h-1
Manufacturer	Cusabio
Amount	1 mg
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
Host	E.coli
Conjugate/Tag	GST
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MSTVHEILCKLSLEGDHSTPPSAYGSVKAYTNFDA ERDALNIETAIKTKGVDEVTIVNILTNRSNAQRQD IAFAYQRRTKKELASALKSALSGHLETVILGLLKT PAQYDASELKASMKGLGTDEDSLIEIICSRTNQEL QEINRVYKEMYKTDLEKDIISDTSGDFRKLMVALA KGRRAEDGSVIDYELIDQDARDLYDAGVKRKGTDV PKWISIMTERSVPHLQKVFDRYKSYSPYDMLESIR KEV
Citations	Two human 35 kd inhibitors of phospholipase A2 are related to substrates of pp60v-src and of the epidermal growth factor receptor/kinase.Huang K.-S., Wallner B.P., Mattaliano R.J., Tizard R., Burne C., Frey A., Hession C., McGray P., Sinclair L.K., Chow E.P., Browning J.L., Ramachandran K.L., Tang J., Smart J.E., Pepinsky R.B.Cell 46:191-199(1986)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Annexin IIAnnexin-2;Calpactin I heavy chain;Calpactin-1 heavy chain;Chromobindin-8Lipocortin IIPlacental anticoagulant protein IV ;PAP-IVProtein Ip36
Available
Manufacturer - Conjugate / Tag	N-terminal GST-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	MW of Fusion: 65, 6
General Research Areas	Signal Transduction
Relevance	Calcium-regulated mbrane-binding protein whose affinity for calcium is greatly enhanced by anionic phospholipids. It binds two calcium ions with high affinity. May be involved in heat-stress response.
Expression Region	1-339aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Gene Names	ANXA2
Sequence Info	Full Length
Storage Buffer	Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1 mg

not available