Hersteller |
Cusabio
|
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
other |
Menge |
200ug |
Host |
E.coli |
ArtNr |
CSB-RP013854h-200 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Lieferbar |
|
Research Topic |
Immunology |
Uniprot ID |
P49721 |
Gene Names |
PSMB2 |
Organism |
Homo sapiens (Human) |
AA Sequence |
MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKM FKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMR NGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLA GYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTL SILDRYYTPTISRERAVELLRKCLEELQKRFILNL PTFSVRIIDKNGIHDLDNISFPKQGS |
Expression Region |
1-201aa |
Sequence Info |
Full Length |
Source |
E.coli |
Tag Info |
N-terminal GST-tagged |
MW |
49.8 kDa |
Alternative Name(s) |
Macropain subunit C7-IMulticatalytic endopeptidase complex subunit C7-IProteasome component C7-I |
Relevance |
The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. This subunit has a trypsin-like activity. |
Reference |
Sequence analyses and inter-species comparisons of three novel human proteasomal subunits, HsN3, HsC7-I and HsC10-II, confine potential proteolytic active-site residues.Nothwang H.G., Tamura T., Tanaka K., Ichihara A.Biochim. Biophys. Acta 1219:361-368(1994) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Component of the 20S core proteasome complex involved in the proteolytic degradation of most intracellular proteins. This complex plays numerous essential roles within the cell by associating with different regulatory particles. Associated with two 19S regulatory particles, forms the 26S proteasome and thus participates in the ATP-dependent degradation of ubiquitinated proteins. The 26S proteasome plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins that could impair cellular functions, and by removing proteins whose functions are no longer required. Associated with the PA200 or PA28, the 20S proteasome mediates ubiquitin-independent protein degradation. This type of proteolysis is required in several pathways including spermatogenesis (20S-PA200 complex) or generation of a subset of MHC class I-presented antigenic peptides (20S-PA28 complex). |
Subcellular Location |
Cytoplasm, Nucleus |
Protein Families |
Peptidase T1B family |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.