Recombinant Human Proteasome subunit beta type-2(PSMB2)

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 200ug
Host E.coli
ArtNr CSB-RP013854h-200
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Immunology
Uniprot ID
P49721
Gene Names
PSMB2
Organism
Homo sapiens (Human)
AA Sequence
MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKM FKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMR NGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLA GYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTL SILDRYYTPTISRERAVELLRKCLEELQKRFILNL PTFSVRIIDKNGIHDLDNISFPKQGS
Expression Region
1-201aa
Sequence Info
Full Length
Tag Info
N-terminal GST-tagged
MW
49.8 kDa
Alternative Name(s)
Macropain subunit C7-IMulticatalytic endopeptidase complex subunit C7-IProteasome component C7-I
Relevance
The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. This subunit has a trypsin-like activity.
Reference
Sequence analyses and inter-species comparisons of three novel human proteasomal subunits, HsN3, HsC7-I and HsC10-II, confine potential proteolytic active-site residues.Nothwang H.G., Tamura T., Tanaka K., Ichihara A.Biochim. Biophys. Acta 1219:361-368(1994)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 200ug
Available: In stock
Listprice: €496.43
Price: €496.43
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

Close