« Zurück
Home /
Recombinant Human Prefoldin subunit 5(PFDN5)

Recombinant Human Prefoldin subunit 5(PFDN5)

Hersteller	Cusabio
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Menge	1mg
Host	E.coli
ArtNr	CSB-RP014144h-1
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Areas	Epigenetics and Nuclear Signaling
Uniprot ID	Q99471
Gene Names	PFDN5
Organism	Homo sapiens (Human)
AA Sequence	AQSINITELNLPQLEMLKNQLDQEVEFLSTSIAQL KVVQTKYVEAKDCLNVLNKSNEGKELLVPLTSSMY VPGKLHDVEHVLIDVGTGYYVEKTAEDAKDFFKRK IDFLTKQMEKIQPALQEKHAMKQAVMEMMSQKIQQ LTALGAAQATAKA
Expression Region	2-154aa
Sequence Info	Full Length of Mature Protein
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	44.2 kDa
Alternative Name(s)	C-Myc-binding protein Mm-1Myc modulator 1
Relevance	Binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. Binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins. Represses the transcriptional activity of MYC.
Reference	MM-1, a novel c-Myc-associating protein that represses transcriptional activity of c-Myc.Mori K., Maeda Y., Kitaura H., Taira T., Iguchi-Ariga S.M., Ariga H.J. Biol. Chem. 273:29794-29800(1998)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. Binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins. Represses the transcriptional activity of MYC.
Subcellular Location	Isoform 1: Nucleus, SUBCELLULAR LOCATION: Isoform 2: Cytoplasm, SUBCELLULAR LOCATION: Isoform 3: Nucleus
Protein Families	Prefoldin subunit alpha family
Tissue Specificity	Highly expressed in pancreas and skeletal muscle and moderately in other tissues.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1mg

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen