« Zurück
Home /
Recombinant Human V-type proton ATPase subunit F(ATP6V1F)

Recombinant Human V-type proton ATPase subunit F(ATP6V1F)

Hersteller	Cusabio
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Menge	1mg
Host	E.coli
ArtNr	CSB-RP015744h-1
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Topic	Transport
Uniprot ID	Q16864
Gene Names	ATP6V1F
Organism	Homo sapiens (Human)
AA Sequence	MAGRGKLIAVIGDEDTVTGFLLGGIGELNKNRHPN FLVVEKDTTINEIEDTFRQFLNRDDIGIILINQYI AEMVRHALDAHQQSIPAVLEIPSKEHPYDAAKDSI LRRARGMFTAEDLR
Expression Region	1-119aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	40.4 kDa
Alternative Name(s)	V-ATPase 14KDA subunitVacuolar proton pump subunit F
Relevance	Subunit of the peripheral V1 complex of vacuolar ATPase essential for assbly or catalytic function. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.
Reference	"Initial characterization of the human central proteome."Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Subunit of the peripheral V1 complex of vacuolar ATPase essential for assembly or catalytic function. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.
Protein Families	V-ATPase F subunit family
Paythway	mTORsignalingpathway

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-RP015744h-1-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1mg

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen