« Zurück
Home /
Recombinant Human Casein kinase II subunit beta(CSNK2B),partial

Recombinant Human Casein kinase II subunit beta(CSNK2B),partial

Hersteller	Cusabio
Kategorie	Food Safety Allergenes Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	200ug
Host	E.coli
ArtNr	CSB-RP016554h-200
Konjugat/Tag	GST
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Topic	Signal Transduction
Uniprot ID	P67870
Gene Names	CSNK2B
Organism	Homo sapiens (Human)
AA Sequence	SSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNL TGLNEQVPHYRQALDMILDLEPDEELEDNPNQSDL IEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDF GYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCM DVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRP KRPANQFVPRLYGFKIHPMAYQLQLQAASNFKSPV KTIR
Expression Region	2-215aa
Sequence Info	Partial
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	51.8 kDa
Alternative Name(s)	Phosvitin Protein G5a
Relevance	Participates in Wnt signaling (By similarity). Plays a complex role in regulating the basal catalytic activity of the alpha subunit.
Reference	"Complete sequencing and characterization of 21, 243 full-length human cDNAs."Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Tag Information	N-terminal GST-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen