Recombinant Human Casein kinase II subunit beta(CSNK2B),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 200ug
Host E.coli
ArtNr CSB-RP016554h-200
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Signal Transduction
Uniprot ID
P67870
Gene Names
CSNK2B
Organism
Homo sapiens (Human)
AA Sequence
SSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNL TGLNEQVPHYRQALDMILDLEPDEELEDNPNQSDL IEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDF GYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCM DVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRP KRPANQFVPRLYGFKIHPMAYQLQLQAASNFKSPV KTIR
Expression Region
2-215aa
Sequence Info
Partial
Tag Info
N-terminal GST-tagged
MW
51.8 kDa
Alternative Name(s)
Phosvitin
Protein G5a
Relevance
Participates in Wnt signaling (By similarity). Plays a complex role in regulating the basal catalytic activity of the alpha subunit.
Reference
"Complete sequencing and characterization of 21, 243 full-length human cDNAs."Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 200ug
Available: In stock
Listprice: €496.43
Price: €496.43
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

Close