« Zurück
Home /
Recombinant Human Ferritin heavy chain(FTH1)

Recombinant Human Ferritin heavy chain(FTH1)

Hersteller	Cusabio
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Menge	1mg
Host	E.coli
ArtNr	CSB-RP020844h-1
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research areas	Metabolism
Target / Protein	FTH1
Biologically active	Not Test
Expression system	E.coli
Species of origin	Homo sapiens (Human)
Uniprot ID	P02794
AA Sequence	TTASTSQVRQNYHQDSEAAINRQINLELYASYVYL SMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLM KLQNQRGGRIFLQDIKKPDCDDWESGLNAMECALH LEKNVNQSLLELHKLATDKNDPHLCDFIETHYLNE QVKAIKELGDHVTNLRKMGAPESGLAEYLFDKHTL GDSDNES
Tag Info	N-terminal GST-tagged
Expression Region	2-183aa
Protein length	Full Length of Mature Protein
MW	48.1 kDa
Alternative Name(s)	Cysteine-rich protein TTG-1LIM domain only protein 1 ; LMO-1T-cell translocation protein 1
Relevance	May be involved in gene regulation within neural lineage cells potentially by direct DNA binding or by binding to other transcription factors.
References	Human chromosome 11 DNA sequence and analysis including novel gene identification.Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G. , Jaffe D.B., LaButti K., Nicol R., Park H.-S., Seaman C., Sougnez C., Yang X., Zimmer A.R., Zody M.C., Birren B.W., Nusbaum C., Fujiyama A., Hattori M., Rogers J., Lander E.S., Sakaki Y.Nature 440:497-500(2006)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Stores iron in a soluble, non-toxic, readily available form. Important for iron homeostasis. Has ferroxidase activity. Iron is taken up in the ferrous form and deposited as ferric hydroxides after oxidation. Also plays a role in delivery of iron to cells. Mediates iron uptake in capsule cells of the developing kidney (By similarity).
Involvement in disease	Hemochromatosis 5 (HFE5)
Protein Families	Ferritin family
Tissue Specificity	Expressed in the liver.
Paythway	Necroptosis

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1mg

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen