« Zurück
Home /
Recombinant Human D-3-phosphoglycerate dehydrogenase(PHGDH),partial

Recombinant Human D-3-phosphoglycerate dehydrogenase(PHGDH),partial

Hersteller	Cusabio
Kategorie	Neuroscience Aging & Neurological Disorders Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Menge	1mg
Host	E.coli
ArtNr	CSB-RP032554h-1
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Areas	Metabolism
Uniprot ID	O43175
Gene Names	PHGDH
Organism	Homo sapiens (Human)
AA Sequence	AFANLRKVLISDSLDPCCRKILQDGGLQVVEKQNL SKEELIAELQDCEGLIVRSATKVTADVINAAEKLQ VVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSA AELTCGMIMCLARQIPQATASMKDGKWERKKFMGT ELNGKTLGILGLGRIGREVATRMQSFGMKTIGYDP IISPEVSASFGVQQLPLEEIWPLCDFITVHTPLLP STTGLLNDNTFAQCKKGVRVVNCARGGIVDEGALL RALQS
Expression Region	2-251aa
Sequence Info	Partial
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	53.8 kDa
Reference	Nucleotide sequence and differential expression of the human 3-phosphoglycerate dehydrogenase gene.Cho H.M., Jun D.Y., Bae M.A., Ahn J.D., Kim Y.H.Gene 245:193-201(2000)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Catalyzes the reversible oxidation of 3-phospho-D-glycerate to 3-phosphonooxypyruvate, the first step of the phosphorylated L-serine biosynthesis pathway. Also catalyzes the reversible oxidation of 2-hydroxyglutarate to 2-oxoglutarate and the reversible oxidation of (S)-malate to oxaloacetate.
Involvement in disease	Phosphoglycerate dehydrogenase deficiency (PHGDHD); Neu-Laxova syndrome 1 (NLS1)
Protein Families	D-isomer specific 2-hydroxyacid dehydrogenase family

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1mg

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen