Comparison

Recombinant Human D-3-phosphoglycerate dehydrogenase(PHGDH),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 1mg
Host E.coli
Item no. CSB-RP032554h-1
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
AA Sequence
AFANLRKVLISDSLDPCCRKILQDGGLQVVEKQNL SKEELIAELQDCEGLIVRSATKVTADVINAAEKLQ VVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSA AELTCGMIMCLARQIPQATASMKDGKWERKKFMGT ELNGKTLGILGLGRIGREVATRMQSFGMKTIGYDP IISPEVSASFGVQQLPLEEIWPLCDFITVHTPLLP STTGLLNDNTFAQCKKGVRVVNCARGGIVDEGALL RALQS
Research Topic
Metabolism
Uniprot ID
O43175
Gene Names
PHGDH
Tag Info
N-terminal GST-tagged
Expression Region
2-251aa
MW of Fusion Proten
53, 8
Sequence Info
Partial
Reference
Nucleotide sequence and differential expression of the human 3-phosphoglycerate dehydrogenase gene.Cho H.M., Jun D.Y., Bae M.A., Ahn J.D., Kim Y.H.Gene 245:193-201(2000)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 1mg
Available: In stock
Listprice: €1,371.07
Price: €1,371.07
lieferbar

Compare

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

 
Close