« Back
Home /
Recombinant Human D-3-phosphoglycerate dehydrogenase(PHGDH),partial

Recombinant Human D-3-phosphoglycerate dehydrogenase(PHGDH),partial

Manufacturer	Cusabio
Category	Neuroscience Aging & Neurological Disorders Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Amount	1mg
Host	E.coli
Item no.	CSB-RP032554h-1
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Areas	Metabolism
Uniprot ID	O43175
Gene Names	PHGDH
Organism	Homo sapiens (Human)
AA Sequence	AFANLRKVLISDSLDPCCRKILQDGGLQVVEKQNL SKEELIAELQDCEGLIVRSATKVTADVINAAEKLQ VVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSA AELTCGMIMCLARQIPQATASMKDGKWERKKFMGT ELNGKTLGILGLGRIGREVATRMQSFGMKTIGYDP IISPEVSASFGVQQLPLEEIWPLCDFITVHTPLLP STTGLLNDNTFAQCKKGVRVVNCARGGIVDEGALL RALQS
Expression Region	2-251aa
Sequence Info	Partial
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	53.8 kDa
Reference	Nucleotide sequence and differential expression of the human 3-phosphoglycerate dehydrogenase gene.Cho H.M., Jun D.Y., Bae M.A., Ahn J.D., Kim Y.H.Gene 245:193-201(2000)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Catalyzes the reversible oxidation of 3-phospho-D-glycerate to 3-phosphonooxypyruvate, the first step of the phosphorylated L-serine biosynthesis pathway. Also catalyzes the reversible oxidation of 2-hydroxyglutarate to 2-oxoglutarate and the reversible oxidation of (S)-malate to oxaloacetate.
Involvement in disease	Phosphoglycerate dehydrogenase deficiency (PHGDHD); Neu-Laxova syndrome 1 (NLS1)
Protein Families	D-isomer specific 2-hydroxyacid dehydrogenase family

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1mg

available

Request delivery time