« Zurück
Home /
Recombinant Human B-cell receptor-associated protein 31(BCAP31),partial

Recombinant Human B-cell receptor-associated protein 31(BCAP31),partial

Hersteller	Cusabio
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	Human
Format	Liquid or Lyophilized powder
Menge	1mg
Host	E.coli
ArtNr	CSB-RP034254h-1
Konjugat/Tag	GST
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Areas	Apoptosis
Target / Protein	BCAP31
Biologically Active	Not Test
Expression System	E.coli
Species of origin	Homo sapiens (Human)
Uniprot ID	P51572
AA Sequence	SLQWTAVATFLYAEVFVVLLLCIPFISPKRWQKIF KSRLVELLVSYGNTFFVVLIVILVLLVIDAVREIR KYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIA GFSLLLSFLLRRLVTLISQQATLLASNEAFKKQAE SASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVK LEEENRSLKADLQKLKDELASTKQKLEKAENQVLA MRKQSEGLTKEYDRLLEEHAKLQAAVDGPMDK
Tag Info	N-terminal GST-tagged
Expression Region	2-243aa
Protein Length	Partial
MW	54.5 kDa
Distributor Discount	50% off the list price
Alternative Name(s)	6C6-AG tumor-associated antigen; Protein CDMp28
Relevance	Functions as a chaperone protein. Is one of the most abundant endoplasmic reticulum (ER) proteins. Plays a role in the export of secreted proteins in the ER, the recognition of abnormally folded protein and their targeting to the ER associated-degradation (ERAD). Also serves as a cargo receptor for the export of transmbrane proteins. May be involved in CASP8-mediated apoptosis.
Reference	Molecular cloning and characterization of a transmembrane surface antigen in human cells.Li E., Bestagno M., Burrone O.Eur. J. Biochem. 238:631-638(1996)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Functions as a chaperone protein. Is one of the most abundant endoplasmic reticulum (ER) proteins. Plays a role in the export of secreted proteins in the ER, the recognition of abnormally folded protein and their targeting to the ER associated-degradation (ERAD). Also serves as a cargo receptor for the export of transmembrane proteins. May be involved in CASP8-mediated apoptosis.
Involvement in disease	Deafness, dystonia, and cerebral hypomyelination (DDCH)
Subcellular Location	Endoplasmic reticulum membrane, Multi-pass membrane protein, Endoplasmic reticulum-Golgi intermediate compartment membrane, Multi-pass membrane protein
Protein Families	BCAP29/BCAP31 family
Tissue Specificity	Ubiquitous. Highly expressed in neurons and discrete endocrine cells.
Paythway	Proteinprocessinginendoplasmicreticulum
Tag Information	N-terminal GST-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1mg

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen