« Zurück
Home /
Recombinant Human Zinc finger protein 592(ZNF592) ,partial

Recombinant Human Zinc finger protein 592(ZNF592) ,partial

Hersteller	Cusabio
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	200ug
Host	E.coli
ArtNr	CSB-RP036344h-200
Konjugat/Tag	GST
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Topic	Transcription
Uniprot ID	Q92610
Gene Names	ZNF592
Organism	Homo sapiens (Human)
AA Sequence	MGDMKTPDFDDLLAAFDIPDPTSLDAKEAIQTPSE ENESPLKPPGICMDESVSLSHSGSAPDVPAVSVIV KNTSRQESFEAEKDHITPSLLHNGFRGSDLPPDPH NCGKFDSTFMNGDSARSFPGKLEPPKSEPLPTFNQ FSPISSPEPEDPIKDNGFGIKPKHSDSYFPPPLGC GAVGGPVLEALAKFPVPELHMFDHFCKKEPKPEPL PLGSQQEHEQSGQNTVEPHKDPDATRFFGEAL
Expression Region	1-242aa
Sequence Info	Partial
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	53.2 kDa
Relevance	May be involved in transcriptional regulation.
Reference	Prediction of the coding sequences of unidentified human genes. VI. The coding sequences of 80 new genes (KIAA0201-KIAA0280) deduced by analysis of cDNA clones from cell line KG-1 and brain.Nagase T., Seki N., Ishikawa K., Ohira M., Kawarabayasi Y., Ohara O., Tanaka A., Kotani H., Miyajima N., Nomura N.DNA Res. 3:321-329(1996)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	May be involved in transcriptional regulation.
Subcellular Location	Nucleus
Protein Families	Krueppel C2H2-type zinc-finger protein family
Tissue Specificity	Widely expressed, with highest levels in skeletal muscle. Expressed throughout the central nervous system, including in the cerebellum and cerebellar vermis, with higher expression in the substantia nigra. Widely expressed in fetal tissues.
Tag Information	N-terminal GST-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen