Hersteller |
Cusabio
|
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Menge |
200ug |
Host |
E.coli |
ArtNr |
CSB-RP037654h-200 |
Konjugat/Tag |
GST |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Lieferbar |
|
Research Topic |
Transcription |
Uniprot ID |
Q8WX92 |
Gene Names |
NELFB |
Organism |
Homo sapiens (Human) |
AA Sequence |
LGVANGEDLKETLTNCTEPLKAIEQFQTENGVLLP SLQSALPFLDLHGTPRLEFHQSVFDELRDKLLERV SAIASEGKAEERYKKLEDLLEKSFSLVKMPSLQPV VMCVMKHLPKVPEKKLKLVMADKELYRACAVEVKR QIWQDNQALFGDEVSPLLKQYILEKESALFSTELS VLHNFFSPSPKTRRQGE |
Expression Region |
8-199aa |
Sequence Info |
Partial |
Source |
E.coli |
Tag Info |
N-terminal GST-tagged |
MW |
48.9 kDa |
Alternative Name(s) |
Cofactor of BR; CA1 |
Relevance |
Essential component of the NELF complex, a complex that negatively regulates the elongation of transcription by RNA polymerase II. The NELF complex, which acts via an association with the DSIF complex and causes transcriptional pausing, is counteracted by the P-TEFb kinase complex. May be able to induce chromatin unfolding. |
Reference |
BRCA1-induced large-scale chromatin unfolding and allele-specific effects of cancer-predisposing mutations.Ye Q., Hu Y.-F., Zhong H., Nye A.C., Belmont A.S., Li R.J. Cell Biol. 155:911-921(2001) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Essential component of the NELF complex, a complex that negatively regulates the elongation of transcription by RNA polymerase II. The NELF complex, which acts via an association with the DSIF complex and causes transcriptional pausing, is counteracted by the P-TEFb kinase complex. The NELF complex is involved in HIV-1 latency possibly involving recruitment of PCF11 to paused RNA polymerase II. Binds RNA which may help to stabilize the NELF complex on nucleic acid. In vitro, binds weakly to the HIV-1 TAR RNA which is located in the long terminal repeat (LTR) of HIV-1. May be able to induce chromatin unfolding. |
Subcellular Location |
Nucleus |
Protein Families |
NELF-B family |
Tissue Specificity |
Widely expressed. Expressed in heart, brain, lung, placenta, liver, skeletal muscle, kidney and pancreas. |
Tag Information |
N-terminal GST-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.