« Zurück
Home /
Recombinant Human Cytochrome b-c1 complex subunit 8(UQCRQ),partial

Recombinant Human Cytochrome b-c1 complex subunit 8(UQCRQ),partial

Hersteller	Cusabio
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	200ug
Host	E.coli
ArtNr	CSB-RP038554h-200
Konjugat/Tag	GST
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Topic	Transport
Uniprot ID	O14949
Gene Names	UQCRQ
Organism	Homo sapiens (Human)
AA Sequence	GREFGNLTRMRHVISYSLSPFEQRAYPHVFTKGIP NVLRRIRESFFRVVPQFVVFYLIYTWGTEEFERSK RKNPAAY
Expression Region	2-78aa
Sequence Info	Partial
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	36.3 kDa
Alternative Name(s)	Complex III subunit omplex III subunit VIIIUbiquinol-cytochrome c reductase complex 9.5KDA proteinUbiquinol-cytochrome c reductase complex ubiquinone-binding protein QP-C
Relevance	This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This subunit, together with cytochrome b, binds to ubiquinone.
Reference	Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This subunit, together with cytochrome b, binds to ubiquinone.
Involvement in disease	Mitochondrial complex III deficiency, nuclear 4 (MC3DN4)
Subcellular Location	Mitochondrion inner membrane
Protein Families	UQCRQ/QCR8 family
Paythway	Cardiacmusclecontraction
Tag Information	N-terminal GST-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen