« Zurück
Home /
Recombinant Human Transaldolase(TALDO1),partial

Recombinant Human Transaldolase(TALDO1),partial

Hersteller	Cusabio
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	200ug
Host	E.coli
ArtNr	CSB-RP042754h-200
Konjugat/Tag	GST
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Topic	Metabolism
Uniprot ID	P37837
Gene Names	TALDO1
Organism	Homo sapiens (Human)
AA Sequence	QRMESALDQLKQFTTVVADTGDFHAIDEYKPQDAT TNPSLILAAAQMPAYQELVEEAIAYGRKLGGSQED QIKNAIDKLFVLFGAEILKKIPGRVSTEVDARLSF DKDAMVARARRLIELYKEAGISKDRILIKLSSTWE GIQAGKELEEQHGIHCNMTLLFSFAQAVACAEAGV TLISPFVGRILDWHVANTDKKSYEPLEDPGVKSVT KIYNYYKKFSYKTIVMGASFRNTGEIKALAGCDFL TISPKLLGELLQDNAKLVPVLSAKAAQASDLEKIH LDEKSFRWLHNEDQMAVEKLSDGIRKFAADAVKLE RMLTERMFNAENGK
Expression Region	9-337aa
Sequence Info	Partial
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	63.7 kDa
Relevance	Transaldolase is important for the balance of metabolites in the pentose-phosphate pathway.
Reference	Cloning and expression of the human gene for transaldolase. A novel highly repetitive element constitutes an integral part of the coding sequence.Banki K., Halladay D.L., Perl A.J. Biol. Chem. 269:2847-2851(1994)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Transaldolase is important for the balance of metabolites in the pentose-phosphate pathway.
Involvement in disease	Transaldolase deficiency (TALDOD)
Subcellular Location	Cytoplasm
Protein Families	Transaldolase family, Type 1 subfamily
Tag Information	N-terminal GST-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen