« Zurück
Home /
Recombinant Human Cytochrome b-c1 complex subunit Rieske, mitochondrial(UQCRFS1)

Recombinant Human Cytochrome b-c1 complex subunit Rieske, mitochondrial(UQCRFS1)

Hersteller	Cusabio
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	200ug
Host	E.coli
ArtNr	CSB-RP046454h-200
Konjugat/Tag	GST
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Topic	Transport
Uniprot ID	P47985
Gene Names	UQCRFS1
Organism	Homo sapiens (Human)
AA Sequence	SHTDIKVPDFSEYRRLEVLDSTKSSRESSEARKGF SYLVTGVTTVGVAYAAKNAVTQFVSSMSASADVLA LAKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTQKE IEQEAAVELSQLRDPQHDLDRVKKPEWVILIGVCT HLGCVPIANAGDFGGYYCPCHGSHYDASGRIRLGP APLNLEVPTYEFTSDDMVIVG
Expression Region	79-274aa
Sequence Info	Full Length of Mature Protein
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	48.6 kDa
Alternative Name(s)	Complex III subunit 5Cytochrome b-c1 complex subunit 5Rieske iron-sulfur protein ; RISPUbiquinol-cytochrome c reductase iron-sulfur subunit
Relevance	Component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is a respiratory chain that generates an electrochical potential coupled to ATP synthesis.The transit peptide of the Rieske protein ses to form part of the bc1 complex and is considered to be the subunit 11/IX of that complex.
Reference	The primary structure of human Rieske iron-sulfur protein of mitochondrial cytochrome bc1 complex deduced from cDNA analysis.Nishikimi M., Hosokawa Y., Toda H., Suzuki H., Ozawa T.Biochem. Int. 20:155-160(1990)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Cytochrome b-c1 complex subunit Rieske, mitochondrial
Subcellular Location	Mitochondrion inner membrane, Single-pass membrane protein
Paythway	Cardiacmusclecontraction
Tag Information	N-terminal GST-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen