Recombinant Human Cytochrome b-c1 complex subunit Rieske, mitochondrial(UQCRFS1)

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 200ug
Host E.coli
Item no. CSB-RP046454h-200
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Transport
Uniprot ID
P47985
Gene Names
UQCRFS1
Organism
Homo sapiens (Human)
AA Sequence
SHTDIKVPDFSEYRRLEVLDSTKSSRESSEARKGF SYLVTGVTTVGVAYAAKNAVTQFVSSMSASADVLA LAKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTQKE IEQEAAVELSQLRDPQHDLDRVKKPEWVILIGVCT HLGCVPIANAGDFGGYYCPCHGSHYDASGRIRLGP APLNLEVPTYEFTSDDMVIVG
Expression Region
79-274aa
Sequence Info
Full Length of Mature Protein
Tag Info
N-terminal GST-tagged
MW
48.6 kDa
Alternative Name(s)
Complex III subunit 5Cytochrome b-c1 complex subunit 5Rieske iron-sulfur protein ; RISPUbiquinol-cytochrome c reductase iron-sulfur subunit
Relevance
Component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is a respiratory chain that generates an electrochical potential coupled to ATP synthesis.The transit peptide of the Rieske protein ses to form part of the bc1 complex and is considered to be the subunit 11/IX of that complex.
Reference
The primary structure of human Rieske iron-sulfur protein of mitochondrial cytochrome bc1 complex deduced from cDNA analysis.Nishikimi M., Hosokawa Y., Toda H., Suzuki H., Ozawa T.Biochem. Int. 20:155-160(1990)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 200ug
Available: In stock
Listprice: €546.07
Price: €546.07
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

 
Close