Manufacturer |
Cusabio
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Amount |
200ug |
Host |
E.coli |
Item no. |
CSB-RP046454h-200 |
Conjugate/Tag |
GST |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Available |
|
Research Topic |
Transport |
Uniprot ID |
P47985 |
Gene Names |
UQCRFS1 |
Organism |
Homo sapiens (Human) |
AA Sequence |
SHTDIKVPDFSEYRRLEVLDSTKSSRESSEARKGF SYLVTGVTTVGVAYAAKNAVTQFVSSMSASADVLA LAKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTQKE IEQEAAVELSQLRDPQHDLDRVKKPEWVILIGVCT HLGCVPIANAGDFGGYYCPCHGSHYDASGRIRLGP APLNLEVPTYEFTSDDMVIVG |
Expression Region |
79-274aa |
Sequence Info |
Full Length of Mature Protein |
Source |
E.coli |
Tag Info |
N-terminal GST-tagged |
MW |
48.6 kDa |
Alternative Name(s) |
Complex III subunit 5Cytochrome b-c1 complex subunit 5Rieske iron-sulfur protein ; RISPUbiquinol-cytochrome c reductase iron-sulfur subunit |
Relevance |
Component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is a respiratory chain that generates an electrochical potential coupled to ATP synthesis.The transit peptide of the Rieske protein ses to form part of the bc1 complex and is considered to be the subunit 11/IX of that complex. |
Reference |
The primary structure of human Rieske iron-sulfur protein of mitochondrial cytochrome bc1 complex deduced from cDNA analysis.Nishikimi M., Hosokawa Y., Toda H., Suzuki H., Ozawa T.Biochem. Int. 20:155-160(1990) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Cytochrome b-c1 complex subunit Rieske, mitochondrial |
Subcellular Location |
Mitochondrion inner membrane, Single-pass membrane protein |
Paythway |
Cardiacmusclecontraction |
Tag Information |
N-terminal GST-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.