« Zurück
Home /
Recombinant Human Protein canopy homolog 2(CNPY2)

Recombinant Human Protein canopy homolog 2(CNPY2)

Hersteller	Cusabio
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	200ug
Host	E.coli
ArtNr	CSB-RP050344h-200
Konjugat/Tag	GST
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Topic	Metabolism
Uniprot ID	Q9Y2B0
Gene Names	CNPY2
Organism	Homo sapiens (Human)
AA Sequence	RSQDLHCGACRALVDELEWEIAQVDPKKTIQMGSF RINPDGSQSVVEVPYARSEAHLTELLEEICDRMKE YGEQIDPSTHRKNYVRVVGRNGESSELDLQGIRID SDISGTLKFACESIVEEYEDELIEFFSREADNVKD KLCSKRTDLCDHALHISHDEL
Expression Region	22-182aa
Sequence Info	Full Length of Mature Protein
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	45.4 kDa
Alternative Name(s)	MIR-interacting saposin-like protein; Putative secreted protein Zsig9Transmembrane protein 4
Relevance	Positive regulator of neurite outgrowth by stabilizing myosin regulatory light chain (MRLC). It prevents MIR-mediated MRLC ubiquitination and its subsequent proteasomal degradation.
Reference	MSAP is a novel MIR-interacting protein that enhances neurite outgrowth and increases myosin regulatory light chain.Bornhauser B.C., Olsson P.-A., Lindholm D.J. Biol. Chem. 278:35412-35420(2003)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Positive regulator of neurite outgrowth by stabilizing myosin regulatory light chain (MRLC). It prevents MIR-mediated MRLC ubiquitination and its subsequent proteasomal degradation.
Subcellular Location	Endoplasmic reticulum
Protein Families	Canopy family
Tissue Specificity	Expressed in different tissues. Highest levels are detected in adult placenta, liver and pancreas.
Tag Information	N-terminal GST-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen