« Zurück
Home /
Recombinant Human 60S ribosomal protein L10a(RPL10A),partial

Recombinant Human 60S ribosomal protein L10a(RPL10A),partial

Hersteller	Cusabio
Kategorie	Neuroscience Protein Aggregation, Clearance & Misfolding Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	200ug
Host	E.coli
ArtNr	CSB-RP052444h-200
Konjugat/Tag	GST
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Topic	Epigenetics and Nuclear Signaling
Uniprot ID	P62906
Gene Names	RPL10A
Organism	Homo sapiens (Human)
AA Sequence	KVSRDTLYEAVREVLHGNQRKRRKFLETVELQISL KNYDPQKDKRFSGTVRLKSTPRPKFSVCVLGDQQH CDEAKAVDIPHMDIEALKKLNKNKKLVKKLAKKYD AFLASESLIKQIPRILGPGLNKAGKFPSLLTHNEN MVAKVDEVKSTIKFQMKKVLCLAVAVGHVKMTDDE LVYNIHLAVNFLVSLLKKNWQNVRALYIKSTMGKP QR
Expression Region	4-215aa
Sequence Info	Partial
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	51.2 kDa
Alternative Name(s)	CSA-19Neural precursor cell expressed developmentally down-regulated protein 6 ; NEDD-6
Reference	Identification of genes downregulated in the thymus by cyclosporin-A preliminary characterization of clone CSA-19.Fisicaro N., Katerelos M., Williams J., Power D., D'Apice A., Pearse M.Mol. Immunol. 32:565-572(1995)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Component of the large ribosomal subunit.
Protein Families	Universal ribosomal protein uL1 family
Tag Information	N-terminal GST-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen