« Zurück
Home /
Recombinant Human Endoplasmic reticulum resident protein 29(ERP29),partial

Recombinant Human Endoplasmic reticulum resident protein 29(ERP29),partial

Hersteller	Cusabio
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	200ug
Host	E.coli
ArtNr	CSB-RP053444h-200
Konjugat/Tag	GST
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research areas	Signal Transduction
Target / Protein	ERP29
Biologically active	Not Test
Expression system	E.coli
Species of origin	Homo sapiens (Human)
Uniprot ID	P30040
AA Sequence	PLDTVTFYKVIPKSKFVLVKFDTQYPYGEKQDEFK RLAENSASSDDLLVAEVGISDYGDKLNMELSEKYK LDKESYPVFYLFRDGDFENPVPYTGAVKVGAIQRW LKGQGVYLGMPGCLPVYDALAGEFIRASGVEARQA LLKQGQDNLSSVKETQKKWAEQYLKIMGKILDQGE DFPASEMTRIARLIEKNKMSDGKKEELQKSLNILT AF
Tag Info	N-terminal GST-tagged
Expression Region	40-251aa
Protein length	Partial
MW	51.0 kDa
Alternative Name(s)	Endoplasmic reticulum resident protein 28 ; ERp28Endoplasmic reticulum resident protein 31 ; ERp31
Relevance	Does not se to be a disulfide isomerase. Plays an important role in the processing of secretory proteins within the endoplasmic reticulum (ER), possibly by participating in the folding of proteins in the ER.
References	ERp28, a human endoplasmic-reticulum-lumenal protein, is a member of the protein disulfide isomerase family but lacks a CXXC thioredoxin-box motif.Ferrari D.M., van Nguyen P., Kratzin H.D., Soeling H.D.Eur. J. Biochem. 255:570-579(1998)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Does not seem to be a disulfide isomerase. Plays an important role in the processing of secretory proteins within the endoplasmic reticulum (ER), possibly by participating in the folding of proteins in the ER.
Subcellular Location	Endoplasmic reticulum lumen, Melanosome
Tissue Specificity	Ubiquitous. Mostly expressed in secretory tissues.
Paythway	Proteinprocessinginendoplasmicreticulum
Tag Information	N-terminal GST-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen