Recombinant Human Endoplasmic reticulum resident protein 29(ERP29),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 200ug
Host E.coli
Item no. CSB-RP053444h-200
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Signal Transduction
Uniprot ID
P30040
Gene Names
ERP29
Organism
Homo sapiens (Human)
AA Sequence
PLDTVTFYKVIPKSKFVLVKFDTQYPYGEKQDEFK RLAENSASSDDLLVAEVGISDYGDKLNMELSEKYK LDKESYPVFYLFRDGDFENPVPYTGAVKVGAIQRW LKGQGVYLGMPGCLPVYDALAGEFIRASGVEARQA LLKQGQDNLSSVKETQKKWAEQYLKIMGKILDQGE DFPASEMTRIARLIEKNKMSDGKKEELQKSLNILT AF
Expression Region
40-251aa
Sequence Info
Partial
Tag Info
N-terminal GST-tagged
MW
51 kDa
Alternative Name(s)
Endoplasmic reticulum resident protein 28 ; ERp28Endoplasmic reticulum resident protein 31 ; ERp31
Relevance
Does not se to be a disulfide isomerase. Plays an important role in the processing of secretory proteins within the endoplasmic reticulum (ER), possibly by participating in the folding of proteins in the ER.
Reference
ERp28, a human endoplasmic-reticulum-lumenal protein, is a member of the protein disulfide isomerase family but lacks a CXXC thioredoxin-box motif.Ferrari D.M., van Nguyen P., Kratzin H.D., Soeling H.D.Eur. J. Biochem. 255:570-579(1998)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 200ug
Available: In stock
Listprice: €546.07
Price: €546.07
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

 
Close