« Zurück
Home /
Recombinant Human Bone morphogenetic protein 7(BMP7)

Recombinant Human Bone morphogenetic protein 7(BMP7)

Hersteller	Cusabio
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Menge	200ug
Host	E.coli
ArtNr	CSB-RP058054h-200
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Alternative Name(s)	Osteogenic protein 1 ; OP-1INN: Eptotermin alfa
AA Sequence	STGSKQRSQNRSKTPKNQEALRMANVAENSSSDQR QACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGE CAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCA PTQLNAISVLYFDDSSNVILKKYRNMVVRACGCH
Research Topic	Developmental Biology
Uniprot ID	P18075
Gene Names	BMP7
Tag Info	N-terminal GST-tagged
Expression Region	293-431aa
MW of Fusion Proten	42, 7
Sequence Info	Full Length
Relevance	Induces cartilage and bone formation. May be the osteoinductive factor responsible for the phenomenon of epithelial osteogenesis. Plays a role in calcium regulation and bone homeostasis.
Reference	Expression and characterization of a human BMP-7 variant with improved biochemical properties.Swencki-Underwood B., Mills J.K., Vennarini J., Boakye K., Luo J., Pomerantz S., Cunningham M.R., Farrell F.X., Naso M.F., Amegadzie B.Protein Expr. Purif. 57:312-319(2008)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species	Homo sapiens (Human)

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen