Recombinant Human Bone morphogenetic protein 7(BMP7)

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 200ug
Host E.coli
ArtNr CSB-RP058054h-200
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Developmental Biology
Uniprot ID
P18075
Gene Names
BMP7
Organism
Homo sapiens (Human)
AA Sequence
STGSKQRSQNRSKTPKNQEALRMANVAENSSSDQR QACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGE CAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCA PTQLNAISVLYFDDSSNVILKKYRNMVVRACGCH
Expression Region
293-431aa
Sequence Info
Full Length of Mature Protein
Tag Info
N-terminal GST-tagged
MW
42.7 kDa
Alternative Name(s)
Osteogenic protein 1 ; OP-1INN: Eptotermin alfa
Relevance
Induces cartilage and bone formation. May be the osteoinductive factor responsible for the phenomenon of epithelial osteogenesis. Plays a role in calcium regulation and bone homeostasis.
Reference
Expression and characterization of a human BMP-7 variant with improved biochemical properties.Swencki-Underwood B., Mills J.K., Vennarini J., Boakye K., Luo J., Pomerantz S., Cunningham M.R., Farrell F.X., Naso M.F., Amegadzie B.Protein Expr. Purif. 57:312-319(2008)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 200ug
Available: In stock
Listprice: €496.43
Price: €496.43
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

Close