« Back
Home /
Recombinant Human Bone morphogenetic protein 7(BMP7)

Recombinant Human Bone morphogenetic protein 7(BMP7)

Manufacturer	Cusabio
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Amount	200ug
Host	E.coli
Item no.	CSB-RP058054h-200
eClass 6.1	34160400
eClass 9.0	42020190
Available
Alternative Name(s)	Osteogenic protein 1 ; OP-1INN: Eptotermin alfa
AA Sequence	STGSKQRSQNRSKTPKNQEALRMANVAENSSSDQR QACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGE CAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCA PTQLNAISVLYFDDSSNVILKKYRNMVVRACGCH
Research Topic	Developmental Biology
Uniprot ID	P18075
Gene Names	BMP7
Tag Info	N-terminal GST-tagged
Expression Region	293-431aa
MW of Fusion Proten	42, 7
Sequence Info	Full Length
Relevance	Induces cartilage and bone formation. May be the osteoinductive factor responsible for the phenomenon of epithelial osteogenesis. Plays a role in calcium regulation and bone homeostasis.
Reference	Expression and characterization of a human BMP-7 variant with improved biochemical properties.Swencki-Underwood B., Mills J.K., Vennarini J., Boakye K., Luo J., Pomerantz S., Cunningham M.R., Farrell F.X., Naso M.F., Amegadzie B.Protein Expr. Purif. 57:312-319(2008)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species	Homo sapiens (Human)

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 200ug

available

Request delivery time