« Zurück
Home /
Recombinant Human CD40 ligand(CD40LG),partial

Recombinant Human CD40 ligand(CD40LG),partial

Hersteller	Cusabio
Kategorie	Neuroscience Neural Lineage Markers Aging & Neurological Disorders Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	200ug
Host	E.coli
ArtNr	CSB-RP060054h-200
Konjugat/Tag	GST
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Topic	Cardiovascular
Uniprot ID	P29965
Gene Names	CD40LG
Organism	Homo sapiens (Human)
AA Sequence	HRRLDKIEDERNLHEDFVFMKTIQRCNTGERSLSL LNCEEIKSQFEGFVKDIMLNKEETKKENSFEMQKG DQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNN LVTLENGKQLTVKRQGLYYIYAQVTFCSNREASSQ APFIASLCLKSPGRFERILLRAANTHSSAKPCGQQ SIHLGGVFELQPGASVFVNVTDPSQVSHGTGFTSF GL
Expression Region	47-258aa
Sequence Info	Extracellular Domain
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	50.8 kDa
Alternative Name(s)	T-cell antigen Gp39TNF-related activation protein ; TRAPTumor necrosis factor ligand superfamily member 5; CD154
Relevance	Mediates B-cell proliferation in the absence of co-stimulus as well as IgE production in the presence of IL-4. Involved in immunoglobulin class switching.
Reference	Mutations of the CD40 ligand gene and its effect on CD40 ligand expression in patients with X-linked hyper IgM syndrome.Seyama K., Nonoyama S., Gangsaas I., Hollenbaugh D., Pabst H.F., Aruffo A., Ochs H.D.Blood 92:2421-2434(1998)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Cytokine that binds to CD40/TNFRSF5
Involvement in disease	Immunodeficiency with hyper-IgM, type 1 (HIGM1)
Subcellular Location	Cell membrane, Single-pass type II membrane protein, Cell surface, SUBCELLULAR LOCATION: CD40 ligand, soluble form: Secreted
Protein Families	Tumor necrosis factor family
Tissue Specificity	Specifically expressed on activated CD4+ T-lymphocytes.
Paythway	NF-kappaBsignalingpathway
Tag Information	N-terminal GST-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen