« Zurück
Home /
Recombinant Human Interleukin-1 alpha(IL1A)

Recombinant Human Interleukin-1 alpha(IL1A)

Hersteller	Cusabio
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Menge	200ug
Host	E.coli
ArtNr	CSB-RP065654h-200
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Topic	Immunology
Uniprot ID	P01583
Gene Names	IL1A
Organism	Homo sapiens (Human)
AA Sequence	SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRA NDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITV ILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGS ETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWV CLAGGPPSITDFQILENQA
Expression Region	113-271aa
Sequence Info	Full Length of Mature Protein
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	45 kDa
Alternative Name(s)	Hematopoietin-1
Relevance	Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.
Reference	Cloning, sequence and expression of two distinct human interleukin-1 complementary DNAs.March C.J., Mosley B., Larsen A., Cerretti D.P., Braedt G., Price V., Gillis S., Henney C.S., Kronheim S.R., Grabstein K., Conlon P.J., Hopp T.P., Cosman D.Nature 315:641-647(1985)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.
Subcellular Location	Secreted
Protein Families	IL-1 family
Paythway	MAPKsignalingpathway

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen