« Zurück
Home /
Recombinant Human Macrophage migration inhibitory factor(MIF)

Recombinant Human Macrophage migration inhibitory factor(MIF)

Hersteller	Cusabio
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Menge	200ug
Host	E.coli
ArtNr	CSB-RP068674h-200
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research areas	Immunology
Target / Protein	MIF
Biologically active	Not Test
Expression system	E.coli
Species of origin	Homo sapiens (Human)
Uniprot ID	P14174
AA Sequence	PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQ YIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGA QNRSYSKLLCGLLAERLRISPDRVYINYYDMNAAN VGWNNSTFA
Tag Info	N-terminal 6xHis-tagged
Expression Region	2-115aa
Protein length	Full Length of Mature Protein
MW	16.3 kDa
Alternative Name(s)	Glycosylation-inhibiting factor ; GIFL-dopachrome isomeraseL-dopachrome tautomerase (EC:5.3.3.12)Phenylpyruvate tautomerase
Relevance	Pro-inflammatory cytokine. Involved in the innate immune response to bacterial pathogens. The expression of MIF at sites of inflammation suggests a role as mediator in regulating the function of macrophages in host defense. Counteracts the anti-inflammatory activity of glucocorticoids. Has phenylpyruvate tautomerase and dopachrome tautomerase activity (in vitro), but the physiological substrate is not known. It is not clear whether the tautomerase activity has any physiological relevance, and whether it is important for cytokine activity.
References	Molecular cloning of a cDNA encoding a human macrophage migration inhibitory factor.Weiser W.Y., Temple P.A., Witek-Giannotti J.S., Remold H.G., Clark S.C., David J.R.Proc. Natl. Acad. Sci. U.S.A. 86:7522-7526(1989)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Pro-inflammatory cytokine. Involved in the innate immune response to bacterial pathogens. The expression of MIF at sites of inflammation suggests a role as mediator in regulating the function of macrophages in host defense. Counteracts the anti-inflammatory activity of glucocorticoids. Has phenylpyruvate tautomerase and dopachrome tautomerase activity (in vitro), but the physiological substrate is not known. It is not clear whether the tautomerase activity has any physiological relevance, and whether it is important for cytokine activity.
Involvement in disease	Rheumatoid arthritis systemic juvenile (RASJ)
Subcellular Location	Secreted, Cytoplasm
Protein Families	MIF family

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen