« Zurück
Home /
Recombinant Human Interstitial collagenase(MMP1),partial

Recombinant Human Interstitial collagenase(MMP1),partial

Hersteller	Cusabio
Kategorie	Neuroscience Neuroinflammation Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Menge	200ug
Host	E.coli
ArtNr	CSB-RP070094h-200
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research areas	Developmental Biology
Target / Protein	MMP1
Biologically active	Not Test
Expression system	E.coli
Species of origin	Homo sapiens (Human)
Uniprot ID	P03956
AA Sequence	VLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIE KAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRD NSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTN NFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSY TFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTP KACDSKLTFDAITTIRGEVMFFKDRFYMRTNPFYP EVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKG NKYWAVQGQNVLHGYPKDIYSSFGFPRTVKHIDAA LSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMI AHDFPGIGHKVDAVFMKDGFFYFFHGTRQYKFDPK TKRILTLQKANSWFNCRKN
Tag Info	N-terminal 6xHis-tagged
Expression Region	101-469aa
Protein length	Partial
MW	46.5 kDa
Alternative Name(s)	Fibroblast collagenase; Matrix metalloproteinase-1 ; MMP-1
Relevance	Cleaves collagens of types I, II, and III at one site in the helical domain. Also cleaves collagens of types VII and X. In case of HIV infection, interacts and cleaves the secreted viral Tat protein, leading to a decrease in neuronal Tat's mediated neurotoxicity.
References	Cloning and characterization of human tumor cell interstitial collagenase.Templeton N.S., Brown P.D., Levy A.T., Margulies I.M.K., Liotta L.A., Stetler-Stevenson W.G.Cancer Res. 50:5431-5437(1990)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Cleaves collagens of types I, II, and III at one site in the helical domain. Also cleaves collagens of types VII and X
Subcellular Location	Secreted, extracellular space, extracellular matrix
Protein Families	Peptidase M10A family
Paythway	PPARsignalingpathway

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen