« Zurück
Home /
Recombinant Human Tumor necrosis factor receptor superfamily member 1A(TNFRSF1A),partial

Recombinant Human Tumor necrosis factor receptor superfamily member 1A(TNFRSF1A),partial

Hersteller	Cusabio
Kategorie	Metabolism Diabetes Glucose Homeostasis Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	200ug
Host	E.coli
ArtNr	CSB-RP072244h-200
Konjugat/Tag	GST
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Topic	Apoptosis
Uniprot ID	P19438
Gene Names	TNFRSF1A
Organism	Homo sapiens (Human)
AA Sequence	VPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKG TYLYNDCPGPGQDTDCRECESGSFTASENHLRHCL SCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHY WSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHA GFFLRENECVSCSNCKKSLECTKLCLPQIENVKGT EDSGT
Expression Region	31-210aa
Sequence Info	Partial
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	47.2 kDa
Alternative Name(s)	Tumor necrosis factor receptor 1 ; TNF-R1Tumor necrosis factor receptor type I ; TNF-RI ; TNFR-Ip55p60; CD120a
Relevance	Receptor for TNFSF2/TNF-alpha and homotrimeric TNFSF1/lymphotoxin-alpha. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. Contributes to the induction of non-cytocidal TNF effects including anti-viral state and activation of the acid sphingomyelinase.
Reference	Discovery of novel human transcript variants by analysis of intronic single-block EST with polyadenylation site.Wang P., Yu P., Gao P., Shi T., Ma D.BMC Genomics 10:518-518(2009)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Receptor for TNFSF2/TNF-alpha and homotrimeric TNFSF1/lymphotoxin-alpha. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. Contributes to the induction of non-cytocidal TNF effects including anti-viral state and activation of the acid sphingomyelinase.
Involvement in disease	Familial hibernian fever (FHF); Multiple sclerosis 5 (MS5)
Subcellular Location	Cell membrane, Single-pass type I membrane protein, Golgi apparatus membrane, Single-pass type I membrane protein, Secreted, Note=A secreted form is produced through proteolytic processing, SUBCELLULAR LOCATION: Isoform 4: Secreted
Paythway	MAPKsignalingpathway
Tag Information	N-terminal GST-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen