Vergleich

Recombinant Human Heparin-binding growth factor 2 protein(FGFB)

ArtNr CSB-RP128494h-200
Hersteller Cusabio
Menge 200 ug
Quantity options 1 mg 10 ug 100 ug 200 ug 50 ug 500 ug
Kategorie
Typ Proteins Recombinant
Specific against Human (Homo sapiens)
Host E.coli
Konjugat/Tag HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIH PDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCA NRYLAMKEDGRLLASKCVTDECFFFERLESNNYNT YRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFL PMSAKS
Citations "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Basic fibroblast growth factor; Short name:; bFGF; Heparin-binding growth factor 2; Short name:; HBGF-2
Lieferbar
Manufacturer - Conjugate / Tag
N-terminal 6xHis-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
MW of Fusion: 20, 4
General Research Areas
Signal Transduction
Relevance
Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro. Can induce angiogenesis (PubMed:23469107).
Expression Region
143-288aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Gene Names
FGFB
Sequence Info
Full Length
Storage Buffer
Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 200 ug
Lieferbar: In stock
lieferbar

Lieferung vsl. bis 23.10.2025 

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen