« Zurück
Startseite /
Recombinant Human Urokinase-type plasminogen activator(PLAU),partial

Recombinant Human Urokinase-type plasminogen activator(PLAU),partial

ArtNr	CSB-RP143194h(A4)-500
Hersteller	Cusabio
Menge	500 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Food Safety Proteins Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Konjugat/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	SNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPK KFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRP CLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNP DNRRRPWCYVQVGLKPLVQECMVHDCADGKKPSSP PEELKFQCGQKTL
Protein Familie	Peptidase S1 family
Citations	"Complete sequencing and characterization of 21,243 full-length human cDNAs."Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	21.3 kDa
General Research Areas	Cardiovascular
Relevance	Specifically cleaves the zymogen plasminogen to form the active enzyme plasmin.
Expression Region	21-173aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Specifically cleaves the zymogen plasminogen to form the active enzyme plasmin.
Subcellular Location	Secreted
Tissue Specificity	Expressed in the prostate gland and prostate cancers.
Involvement in disease	Quebec platelet disorder (QPD)
Paythway	NF-kappaBsignalingpathway
Gene Names	PLAU
Sequence Info	Partial
Organism	Homo sapiens (Human)
Storage Buffer	Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 500 ug

lieferbar

Lieferung vsl. bis 30.10.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern