Vergleich

Recombinant Human Low-density lipoprotein receptor-related protein 2(LRP2),partial

ArtNr CSB-YP013096HU-200
Hersteller Cusabio
Menge 200 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie
Typ Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against other
Host Yeast
Konjugat/Tag HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence NCTASQFKCASGDKCIGVTNRCDGVFDCSDNSDEA GCPTRPPGMCHSDEFQCQEDGICIPNFWECDGHPD CLYGSDEHNACVPKTCPSSYFHCDNGNCIHRAWLC DRDNDCGDMSDEKDCPTQPFRCPSWQWQCLGHNIC VNLSVVCDGIFDCPNGTDESPLCNGNSCSDFNGGC THECVQEPFGAKCLCPLGFLLANDSKTCE
Protein Familie LDLR family
Citations A protein involved in calcium sensing of the human parathyroid and placental cytotrophoblast cells belongs to the LDL-receptor protein superfamily.Lundgren S., Hjaelm G., Hellman P., Ek B., Juhlin C., Rastad J., Klareskog L., Aakerstroem G., Rask L.Exp. Cell Res. 212:344-350(1994)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Glycoprotein 330 ;gp330Megalin
Lieferbar
Manufacturer - Conjugate / Tag
N-terminal 6xHis-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
24.2 kDa
General Research Areas
Immunology
Relevance
Acts together with cubilin to mediate HDL endocytosis . May participate in regulation of parathyroid-hormone and para-thyroid-hormone-related protein release.
Expression Region
1186-1389aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Multiligand endocytic receptor (By similarity). Acts together with CUBN to mediate endocytosis of high-density lipoproteins (By similarity). Mediates receptor-mediated uptake of polybasic drugs such as aprotinin, aminoglycosides and polymyxin B (By similarity). In the kidney, mediates the tubular uptake and clearance of leptin (By similarity). Also mediates transport of leptin across the blood-brain barrier through endocytosis at the choroid plexus epithelium (By similarity). Endocytosis of leptin in neuronal cells is required for hypothalamic leptin signaling and leptin-mediated regulation of feeding and body weight (By similarity). Mediates endocytosis and subsequent lysosomal degradation of CST3 in kidney proximal tubule cells (By similarity). Mediates renal uptake of 25-hydroxyvitamin D3 in complex with the vitamin D3 transporter GC/DBP (By similarity). Mediates renal uptake of metallothionein-bound heavy metals
Subcellular Location
Apical cell membrane, Single-pass type I membrane protein, Endosome lumen, Membrane, coated pit, Cell projection, dendrite, Cell projection, axon
Tissue Specificity
Expressed in first and third trimester cytotrophoblasts in the placenta (at protein level) (PubMed:27798286). Absorptive epithelia, including renal proximal tubules.
Involvement in disease
Donnai-Barrow syndrome (DBS)
Paythway
Hedgehogsignalingpathway
Gene Names
LRP2
Sequence Info
partial
Organism
Homo sapiens (Human)
Storage Buffer
Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 200 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen