Vergleich

Recombinant Mouse Fibroblast growth factor 9(Fgf9) (Active)

ArtNr CSB-AP004131MO-500
Hersteller Cusabio
Menge 500 ug
Quantity options 1 mg 10 ug 50 ug 500 ug
Kategorie
Typ Proteins Recombinant
Format Liquid
Specific against Mouse (Murine, Mus musculus)
Konjugat/Tag HIS
Purity Greater than 95% as determined by SDS-PAGE.
Sequence MAPLGEVGSYFGVQDAVPFGNVPVLPVDSPVLLSD HLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRT GFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLV SIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQF EENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREG TRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS
Protein Familie Heparin-binding growth factors family
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Fibroblast growth factor 9;FGF-9;Glia-activating factor;GAF;heparin-binding growth factor-9;HBGF-9;Fgf9;Fgf-9
Lieferbar
Manufacturer - Category
Cytokine / Growth Factor
Manufacturer - Conjugate / Tag
N-terminal 6xHis-tagged
Molecular Weight
24.4 kDa
General Research Areas
Signal Transduction
Relevance
Fibroblast growth factor-9 (FGF-9) is an approximately 26 kDa secreted glycoprotein of the FGF family. Secreted mouse FGF-9 lacks the N-terminal 1-3 aa and shares >98% sequence identity with rat, human, equine, porcine and bovine FGF-9. FGF-9 plays an important role in the regulation of embryonic development, cell proliferation, cell differentiation and cell migration. In the mouse embryo the location and timing of FGF-9 expression affects development of the skeleton, cerebellum, lungs, heart, vasculature, digestive tract, and testes .It may have a role in glial cell growth and differentiation during development, gliosis during repair and regeneration of brain tissue after damage, differentiation and survival of neuronal cells, and growth stimulation of glial tumors. Deletion of mouse FGF-9 is lethal at birth due to lung hypoplasia, and causes rhizomelia, or shortening of the proximal skeleton. An unusual constitutive dimerization of FGF 9 buries receptor interaction sites which lowers its activity, and increases heparin affinity which inhibits diffusion. A spontaneous mouse mutant, Eks, interferes with dimerization, resulting monomeric, diffusible FGF-9 that causes elbow and knee synostoses (joint fusions) due to FGF-9 misexpression in developing joints.
Function
Plays an important role in the regulation of embryonic development, cell proliferation, cell differentiation and cell migration. May have a role in glial cell growth and differentiation during development, gliosis during repair and regeneration of brain tissue after damage, differentiation and survival of neuronal cells, and growth stimulation of glial tumors.
Subcellular Location
Secreted
Gene Names
Fgf9
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Storage Buffer
0.2 um Filtered 20 mM Tris-HCl, 150 mM NaCl, 5% Trehalose, 1 mM EDTA, 20% Glycerol, 1 mM DTT, pH 8.5
Expression Region
1-208aa
Protein Description
Full Length
Biological Activity
The ED50 as determined in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells is less than 10 ng/ml.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 500 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen