« Zurück
Startseite /
Recombinant Mouse E3 ubiquitin-protein ligase MARCHF9 (Marchf9)

Recombinant Mouse E3 ubiquitin-protein ligase MARCHF9 (Marchf9)

ArtNr	CSB-CF667551MO
Hersteller	Cusabio
Menge	1 ea
Typ	Recombinant Proteins
Specific against	Mouse (Murine, Mus musculus)
Purity	Greater than 90% as determined by SDS-PAGE.
Alias	Membrane-associated RING finger protein 9,Membrane-associated RING-CH protein IX,RING-type E3 ubiquitin transferase MARCHF9
Lieferbar
Manufacturer - Type	CF Transmembrane Protein & Developed Protein
Manufacturer - Conjugate / Tag	N-terminal 10xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Molecular Weight	39.4 kDa
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
General Research Areas	Cell Biology
Relevance	E3 ubiquitin-protein ligase that may mediate ubiquitination of MHC-I, CD4 and ICAM1, and promote their subsequent endocytosis and sorting to lysosomes via multivesicular bodies. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates
Expression Region	1-348aa
Protein Length	39.4 kDa
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Gene Names	Marchf9
Activity	Not tested
Endotoxin	Not test
Manufacturer - Format	Liquid or Lyophilized powder
Target Protein Sequence	MLKSRLRMFLNELKLLVLTGGGRPRAEPQPRGGGGGGCGWAPFAGCSARDGDGDEEEYYGSEPRARGLAGDKEPRAGPPPPPAPPPPPPGALDALSLSSSLDSGLRTPQCRICFQGPEQGELLSPCRCDGSVRCTHQPCLIRWISERGSWSCELCYFKYQVLAISTKNPLQWQAISLTVIEKVQIAAIVLGSLFLVASISWLIWSSLSPSAKWQRQDLLFQICYGMYGFMDVVCIGLIVHEGSSVYRIFKRWQAVNQQWKVLNYDKTKDVGGDTGGGAAGKPGPRTSRTSPPAGAPTRPPAAQRMRMRTLLPQRCGYTILHLLGQLRPPDARSSSHSGREVVMRVTTV
Abbreviation	Recombinant Mouse Marchf9 protein
Transmembrane Domain	2TM

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1 ea

nicht lieferbar