Comparison

Recombinant Mouse E3 ubiquitin-protein ligase MARCHF9 (Marchf9)

Item no. CSB-CF667551MO
Manufacturer Cusabio
Amount 1 ea
Type Recombinant Proteins
Specific against Mouse (Murine, Mus musculus)
Purity Greater than 90% as determined by SDS-PAGE.
Alias Membrane-associated RING finger protein 9,Membrane-associated RING-CH protein IX,RING-type E3 ubiquitin transferase MARCHF9
Available
Manufacturer - Type
CF Transmembrane Protein & Developed Protein
Manufacturer - Conjugate / Tag
N-terminal 10xHis-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Molecular Weight
39.4 kDa
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
General Research Areas
Cell Biology
Relevance
E3 ubiquitin-protein ligase that may mediate ubiquitination of MHC-I, CD4 and ICAM1, and promote their subsequent endocytosis and sorting to lysosomes via multivesicular bodies. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates
Expression Region
1-348aa
Protein Length
39.4 kDa
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Gene Names
Marchf9
Activity
Not tested
Endotoxin
Not test
Manufacturer - Format
Liquid or Lyophilized powder
Target Protein Sequence
MLKSRLRMFLNELKLLVLTGGGRPRAEPQPRGGGGGGCGWAPFAGCSARDGDGDEEEYYGSEPRARGLAGDKEPRAGPPPPPAPPPPPPGALDALSLSSSLDSGLRTPQCRICFQGPEQGELLSPCRCDGSVRCTHQPCLIRWISERGSWSCELCYFKYQVLAISTKNPLQWQAISLTVIEKVQIAAIVLGSLFLVASISWLIWSSLSPSAKWQRQDLLFQICYGMYGFMDVVCIGLIVHEGSSVYRIFKRWQAVNQQWKVLNYDKTKDVGGDTGGGAAGKPGPRTSRTSPPAGAPTRPPAAQRMRMRTLLPQRCGYTILHLLGQLRPPDARSSSHSGREVVMRVTTV
Abbreviation
Recombinant Mouse Marchf9 protein
Transmembrane Domain
2TM

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 1 ea
Available: Out of stock
Questions about this Product?
 
Close