« Zurück
Startseite /
Recombinant Mouse Interleukin-2 receptor subunit beta(Il2rb),partial

Recombinant Mouse Interleukin-2 receptor subunit beta(Il2rb),partial

ArtNr	CSB-EP011650MO-500
Hersteller	Cusabio
Menge	500 ug
Quantity options	1 mg 10 ug 100 ug 200 ug 50 ug 500 ug
Kategorie	Oncology Neuroscience Neural Lineage Markers Peptides & Proteins Recombinant Proteins By Organ Lung Cancer Skin Cancer Lymphatic System Cancer
Typ	Proteins Recombinant
Specific against	other
Host	E.coli
Konjugat/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	ASAAVKNCSHLECFYNSRANVSCMWSHEEALNVTT CHVHAKSNLRHWNKTCELTLVRQASWACNLILGSF PESQSLTSVDLLDINVVCWEEKGWRRVKTCDFHPF DNLRLVAPHSLQVLHIDTQRCNISWKVSQVSHYIE PYLEFEARRRLLGHSWEDASVLSLKQRQQWLFLEM LIPSTSYEVQVRVKAQRNNTGTWSPWSQPLTFRTR PADPMKE
Protein Familie	Type I cytokine receptor family, Type 4 subfamily
Citations	Murine interleukin 2 receptor beta chain dysregulated gene expression in lymphoma line EL-4 caused by a promoter insertion.Kono T., Doi T., Yamada G., Hatakeyama M., Minamoto S., Tsudo M., Miyasaka M., Miyata T., Taniguchi T.Proc. Natl. Acad. Sci. U.S.A. 87:1806-1810(1990)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	High affinity IL-2 receptor subunit betap70-75,CD122
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	29.3 kDa
Buffer	Tris-based buffer, 50% glycerol
Relevance	Receptor for interleukin-2. This beta subunit is involved in receptor mediated endocytosis and transduces the mitogenic signals of IL2.
Expression Region	24-240aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Receptor for interleukin-2. This beta subunit is involved in receptor mediated endocytosis and transduces the mitogenic signals of IL2.
Subcellular Location	Membrane, Single-pass type I membrane protein
Gene Names	l2rb
Sequence Info	Extracellular Domain
Organism	Mus musculus (Mouse)

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 500 ug

lieferbar

Lieferung vsl. bis 12.02.2026

Express-Lieferung: 6 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern