« Zurück
Startseite /
Recombinant Mouse Serine protease 29(Prss29)

Recombinant Mouse Serine protease 29(Prss29)

ArtNr	CSB-EP859566MO-50
Hersteller	Cusabio
Menge	50 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Food Safety Hormones Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Host	E.coli
Konjugat/Tag	SUMO, HIS
Purity	Greater than 85% as determined by SDS-PAGE.
Sequence	GTPAPGPEDVLMGIVGGHSAPQGKWPWQVSLRIYR YYWAFWVHNCGGSIIHPQWVLTAAHCIRERDADPS VFRIRVGEAYLYGGKELLSVSRVIIHPDFVHAGLG SDVALLQLAVSVQSFPNVKPVKLPSESLEVTKKDV CWVTGWGAVSTHRSLPPPYRLQQVQVKIIDNSLCE EMYHNATRHRNRGQKLILKDMLCAGNQGQDSCYGD SGGPLVCNVTGSWTLVGVVSWGYGCALRDFPGVYA RVQ
Protein Familie	Peptidase S1 family
Citations	"Regulation of the strypsin-related proteinase ISP2 by progesterone in endometrial gland epithelium during implantation in mice." O'Sullivan C.M., Liu S.Y., Rancourt S.L., Rancourt D.E. Reproduction 122:235-244(2001)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Implantation serine proteinase 2,Isp2
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-SUMO-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	45.1 kDa
Buffer	Tris-based buffer, 50% glycerol
General Research Areas	Cancer
Relevance	Involved in embryo hatching and implantation.
Expression Region	18-279aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Involved in embryo hatching and implantation.
Subcellular Location	Secreted
Tissue Specificity	Expressed in embryos and placenta. Found in uterus especially in glandular epithelium during zona lysis and implantation.
Gene Names	Prss29
Sequence Info	Full Length of Mature Protein
Organism	Mus musculus (Mouse)
Manufacturer - Format	Liquid or Lyophilized powder

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP859566MO-50-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50 ug

lieferbar

Lieferung vsl. bis 30.10.2025

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern