« Zurück
Startseite /
Recombinant Mouse LIM and senescent cell antigen-like-containing domain protein 1(Lims1)

Recombinant Mouse LIM and senescent cell antigen-like-containing domain protein 1(Lims1)

ArtNr	CSB-BP859129MO-1
Hersteller	Cusabio
Menge	1 mg
Quantity options	1 mg 10 ug 100 ug 20 ug 50 ug 500 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Baculovirus-Infected Insect Cells
Konjugat/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	ANALASATCERCKGGFAPAEKIVNSNGELYHEQCF VCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPCC HQCGEFIIGRVIKAMNNSWHPECFRCDLCQEVLAD IGFVKNAGRHLCRPCHNREKARGLGKYICQKCHAI IDEQPLIFKNDPYHPDHFNCANCGKELTADARELK GELYCLPCHDKMGVPICGACRRPIEGRVVNAMGKQ WHVEHFVCAKCEKPFLGHRHYERKGLAYCETHYNQ LFG
Citations	"PINCH1 plays an essential role in early murine embryonic development but is dispensable in ventricular cardiomyocytes." Liang X., Zhou Q., Li X., Sun Y., Lu M., Dalton N., Ross J. Jr., Chen J. Mol. Cell. Biol. 25:3056-3062(2005)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Particularly interesting new Cys-His protein 1 (PINCH-1) (Pinch1)
Lieferbar
Manufacturer - Targets	Lims1
Manufacturer - Conjugate / Tag	N-terminal 10xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	39.6 kDa
General Research Areas	Cancer
Relevance	Adapter protein in a cytoplasmic complex linking beta-integrins to the actin cytoskeleton, bridges the complex to cell surface receptor tyrosine kinases and growth factor receptors. Involved in the regulation of cell survival, cell proliferation and cell differentiation.
Expression Region	2-325aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Adapter protein in a cytoplasmic complex linking beta-integrins to the actin cytoskeleton, bridges the complex to cell surface receptor tyrosine kinases and growth factor receptors. Involved in the regulation of cell survival, cell proliferation and cell differentiation.
Subcellular Location	Cell junction, focal adhesion, Cell membrane, Peripheral membrane protein, Cytoplasmic side
Biologically active	Not Test
Protein length	Full Length of Mature Protein

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-BP859129MO-1-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1 mg

lieferbar

Lieferung vsl. bis 23.10.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern