« Zurück
Startseite /
Recombinant Mouse Transmembrane protease serine 6(Tmprss6),partial

Recombinant Mouse Transmembrane protease serine 6(Tmprss6),partial

ArtNr	CSB-BP880561MO-1
Hersteller	Cusabio
Menge	1 mg
Quantity options	1 mg 10 ug 100 ug 20 ug 50 ug 500 ug
Kategorie	Oncology Food Safety Proteins Peptides & Proteins Recombinant Proteins By Organ Uterine, Ovarian & Cervical Cancer
Typ	Proteins Recombinant
Specific against	other
Konjugat/Tag	Myc, HIS
Purity	Greater than 85% as determined by SDS-PAGE.
Sequence	KAEVTVSQVYSGSLRVLNRHFSQDLGRRESIAFRS ESAKAQKMLQELVASTRLGTYYNSSSVYSFGEGPL TCFFWFILDIPEYQRLTLSPEVVRELLVDELLSNS STLASYKTEYEVDPEGLVILEASVNDIVVLNSTLG CYRYSYVNPGQVLPLKGPDQQTTSCLWHLQGPEDL MIKVRLEWTRVDCRDRVAMYDAAGPLEKRLITSVY GCSRQEPVMEVLASGSVMAVVWKKGMHSYYDPFLL SVK
Protein Familie	Peptidase S1 family
Citations	"Membrane anchored serine proteases: a rapidly expanding group of cell surface proteolytic enzymes with potential roles in cancer." Netzel-Arnett S., Hooper J.D., Szabo R., Madison E.L., Quigley J.P., Bugge T.H., Antalis T.M. Cancer Metastasis Rev. 22:237-258(2003)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Matriptase-2
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	86.1 kDa
Buffer	Tris-based buffer, 50% glycerol
General Research Areas	Cell Biology
Relevance	Serine protease which hydrolyzes a range of proteins including type I collagen, fibronectin and fibrinogen. Can also activate urokinase-type plasminogen activator with low efficiency. May play a specialized role in matrix remodeling processes in liver. Through the cleavage of HFE2, a regulator of the expression of the iron absorption-regulating hormone hepicidin/HAMP, plays a role in iron homeostasis.
Expression Region	81-811aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Serine protease which hydrolyzes a range of proteins including type I collagen, fibronectin and fibrinogen. Can also activate urokinase-type plasminogen activator with low efficiency. May play a specialized role in matrix remodeling processes in liver. Through the cleavage of HFE2, a regulator of the expression of the iron absorption-regulating hormone hepicidin/HAMP, plays a role in iron homeostasis.
Subcellular Location	Cell membrane, Single-pass type II membrane protein
Tissue Specificity	Expressed at highest levels in adult mice liver, kidney and uterus. Also strongly expressed within the nasal cavity by olfactory epithelial cells. A weak, but detectable, signal in adult mice tissues analyzed including brain, lung, heart, kidney, spleen, muscle, intestine, thymus and pancreas. No signal in residual embryonic yolk sac, developing kidney tubules or in embryonic tissues analyzed including lung, heart, gastrointestinal tract and epithelium of the oral cavity.
Gene Names	Tmprss6
Sequence Info	Extracellular Domain
Organism	Mus musculus (Mouse)
Manufacturer - Format	Liquid or Lyophilized powder

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-BP880561MO-1-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1 mg

lieferbar

Lieferung vsl. bis 30.10.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern