« Zurück
Startseite /
Recombinant Human Diacylglycerol kinase epsilon(DGKE)

Recombinant Human Diacylglycerol kinase epsilon(DGKE)

ArtNr	CSB-CF006835HU-10
Hersteller	Cusabio
Menge	10 ug
Quantity options	10 ug 100 ug 20 ug 50 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Konjugat/Tag	Myc, SUMO, HIS
Purity	Greater than 85% as determined by SDS-PAGE.
Sequence	MEAERRPAPGSPSEGLFADGHLILWTLCSVLLPVF ITFWCSLQRSRRQLHRRDIFRKSKHGWRDTDLFSQ PTYCCVCAQHILQGAFCDCCGLRVDEGCLRKADKR FQCKEIMLKNDTKVLDAMPHHWIRGNVPLCSYCMV CKQQCGCQPKLCDYRCIWCQKTVHDECMKNSLKNE KCDFGEFKNLIIPPSYLTSINQMRKDKKTDYEVLA SKLGKQWTPLIILANSRSGTNMGEGLLGEFRILLN PVQ
Protein Familie	Eukaryotic diacylglycerol kinase family
Citations	"Functional specialization of beta-arrestin interactions revealed by proteomic analysis." Xiao K., McClatchy D.B., Shukla A.K., Zhao Y., Chen M., Shenoy S.K., Yates J.R., Lefkowitz R.J. Proc. Natl. Acad. Sci. U.S.A. 104:12011-12016(2007)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Diglyceride kinase epsilon
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	83.9 kDa
General Research Areas	Signal Transduction
Relevance	Highly selective for arachidonate-containing species of diacylglycerol (DAG). May terminate signals transmitted through arachidonoyl-DAG or may contribute to the synthesis of phospholipids with defined fatty acid composition.
Expression Region	1-567aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Highly selective for arachidonate-containing species of diacylglycerol (DAG). May terminate signals transmitted through arachidonoyl-DAG or may contribute to the synthesis of phospholipids with defined fatty acid composition.
Subcellular Location	Membrane, Multi-pass membrane protein, Membrane, Cytoplasm
Tissue Specificity	Expressed predominantly in testis. Expressed in endothelium, platelets and podocytes (at protein level).
Involvement in disease	Nephrotic syndrome 7 (NPHS7); Hemolytic uremic syndrome atypical 7 (AHUS7)
Paythway	OxidativePhosphorylation
Gene Names	DGKE
Sequence Info	Full Length
Organism	Homo sapiens (Human)
Storage Buffer	Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-CF006835HU-10-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10 ug

lieferbar

Lieferung vsl. bis 09.10.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern