« Zurück
Startseite /
Recombinant Mouse High affinity immunoglobulin epsilon receptor subunit alpha(Fcer1a)

Recombinant Mouse High affinity immunoglobulin epsilon receptor subunit alpha(Fcer1a)

ArtNr	CSB-CF008532MO-10
Hersteller	Cusabio
Menge	10 ug
Quantity options	10 ug 100 ug 20 ug 50 ug
Kategorie	Food Safety Histamines Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Host	E.coli
Konjugat/Tag	SUMO, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	ATEKSVLTLDPPWIRIFTGEKVTLSCYGNNHLQMN STTKWIHNGTVSEVNSSHLVIVSATVQDSGKYICQ KQGLFKSKPVYLNVTQDWLLLQTSADMVLVHGSFD IRCHGWKNWNVRKVIYYRNDHAFNYSYESPVSIRE ATLNDSGTYHCKGYLRQVKYESDKFRIAVVKAYKC KYYWLQLIFPLLVAILFAVDTGLLLSTEEQFKSVL EIQKTGKYKKVETELLT
Citations	"Transcription mapping and expression analysis of candidate genes in the vicinity of the mouse Loop-tail mutation." Underhill D.A., Vogan K.J., Kibar Z., Morrison J., Rommens J., Gros P. Mamm. Genome 11:633-638(2000)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Fc-epsilon RI-alpha
Lieferbar
Manufacturer - Targets	Fcer1a
Manufacturer - Conjugate / Tag	N-terminal 10xHis-SUMO-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	44.7 kDa
General Research Areas	Immunology
Relevance	Binds to the Fc region of immunoglobulins epsilon. High affinity receptor. Responsible for initiating the allergic response. Binding of allergen to receptor-bound IgE leads to cell activation and the release of mediators (such as histamine) responsible for the manifestations of allergy. The same receptor also induces the secretion of important lymphokines.
Expression Region	24-250aa
Protein Length	Full Length of Mature Protein
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Binds to the Fc region of immunoglobulins epsilon. High affinity receptor. Responsible for initiating the allergic response. Binding of allergen to receptor-bound IgE leads to cell activation and the release of mediators (such as histamine) responsible for the manifestations of allergy. The same receptor also induces the secretion of important lymphokines.
Subcellular Location	Cell membrane, Single-pass type I membrane protein
Tissue Specificity	Expressed in bone marrow mast cells, as well as in the pineal gland at night.
Biological activity	Not Test
Manufacturer - Format	Liquid or Lyophilized powder

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-CF008532MO-10-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10 ug

lieferbar

Lieferung vsl. bis 30.10.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern