« Zurück
Startseite /
Recombinant Human Bone marrow proteoglycan(PRG2),partial

Recombinant Human Bone marrow proteoglycan(PRG2),partial

ArtNr	CSB-CF018670HU(F1)-10
Hersteller	Cusabio
Menge	10 ug
Quantity options	10 ug 100 ug 50 ug
Kategorie	Oncology Food Safety Histamines Peptides & Proteins Recombinant Proteins By Organ Bone Cancer
Typ	Proteins Recombinant
Specific against	other
Konjugat/Tag	SUMO, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	TCRYLLVRSLQTFSQAWFTCRRCYRGNLVSIHNFN INYRIQCSVSALNQGQVWIGGRITGSGRCRRFQWV DGSRWNFAYWAAHQPWSRGGHCVALCTRGGHWRRA HCLRRLPFICSY
Citations	"Cloning and sequence analysis of the human gene encoding eosinophil major basic protein."Barker R.L., Loegering D.A., Arakawa K.C., Pease L.R., Gleich G.J.Gene 86:285-289(1990)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Proteoglycan 2,Cleaved into the following chain:,Eosinophil granule major basic protein,EMBP,MBP,Pregnancy-associated major basic protein
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-SUMO-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	MW of Fusion: 29, 8
Buffer	Tris-based buffer, 50% glycerol
General Research Areas	Immunology
Relevance	Cytotoxin and helminthotoxin. Also induces non-cytolytic histamine release from human basophils. Involved in antiparasitic defense mechanisms and immune hypersensitivity reactions. The proform acts as a proteinase inhibitor, reducing the activity of PAPPA.
Expression Region	106-222aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Gene Names	PRG2
Sequence Info	Partial
Organism	Homo sapiens(Human)

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10 ug

lieferbar

Lieferung vsl. bis 30.10.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern