« Zurück
Startseite /
Recombinant Arachis hypogaea Allergen Ara h 1, clone P41B

Recombinant Arachis hypogaea Allergen Ara h 1, clone P41B

ArtNr	CSB-CF337356ANE-50
Hersteller	Cusabio
Menge	50 ug
Quantity options	10 ug 100 ug 20 ug 50 ug
Kategorie	Food Safety Allergenes Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Konjugat/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	KSSPYQKKTENPCAQRCLQSCQQEPDDLKQKACES RCTKLEYDPRCVYDPRGHTGTTNQRSPPGERTRGR QPGDYDDDRRQPRREEGGRWGPAGPREREREEDWR QPREDWRRPSHQQPRKIRPEGREGEQEWGTPGSHV REETSRNNPFYFPSRRFSTRYGNQNGRIRVLQRFD QRSRQFQNLQNHRIVQIEAKPNTLVLPKHADADNI LVIQQGQATVTVANGNNRKSFNLDEGHALRIPSGF ISY
Protein Familie	7S seed storage protein family
Citations	"Structure and organization of the genomic clone of a major peanut allergen gene, Ara h 1." Viquez O.M., Konan K.N., Dodo H.W. Mol. Immunol. 40:565-571(2003)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Allergen Ara h I,Allergen: Ara h 1
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	72.8 kDa
Buffer	Tris-based buffer, 50% glycerol
General Research Areas	Allergen
Expression Region	26-626aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Sequence Info	Full Length of Mature Protein
Organism	Arachis hypogaea (Peanut)
Manufacturer - Format	Liquid or Lyophilized powder

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-CF337356ANE-50-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50 ug

lieferbar

Lieferung vsl. bis 15.01.2026

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern