Hersteller |
Cusabio
|
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Menge |
10ug |
ArtNr |
CSB-CF854119HU-10 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Lieferbar |
|
Research Topic |
Cancer |
Uniprot ID |
Q8NFT2 |
Gene Names |
STEAP2 |
Organism |
Homo sapiens (Human) |
AA Sequence |
MESISMMGSPKSLSETFLPNGINGIKDARKVTVGV IGSGDFAKSLTIRLIRCGYHVVIGSRNPKFASEFF PHVVDVTHHEDALTKTNIIFVAIHREHYTSLWDLR HLLVGKILIDVSNNMRINQYPESNAEYLASLFPDS LIVKGFNVVSAWALQLGPKDASRQVYICSNNIQAR QQVIELARQLNFIPIDLGSLSSAREIENLPLRLFT LWRGPVVVAISLATFFFLYSFVRDVIHPYARNQQS DFYKIPIEIVNKTLPIVAITLLSLVYLAGLLAAAY QLYYGTKYRRFPPWLETWLQCRKQLGLLSFFFAMV HVAYSLCLPMRRSERYLFLNMAYQQVHANIENSWN EEEVWRIEMYISFGIMSLGLLSLLAVTSIPSVSNA LNWREFSFIQSTLGYVALLISTFHVLIYGWKRAFE EEYYRFYTPPNFVLALVLPSIVILGKIILFLPCIS RKLKRIKKGWEKSQFLEEGMGGTIPHVSPERVTVM |
Expression Region |
1-490aa |
Sequence Info |
Full Length |
Source |
in vitro E.coli expression system |
Tag Info |
N-terminal 10xHis-SUMO-tagged |
MW |
74.6 kDa |
Alternative Name(s) |
Prostate cancer-associated protein 1 Protein up-regulated in metastatic prostate cancer |
Relevance |
Metalloreductase that has the ability to reduce both Fe3+ to Fe2+ and Cu2+ to Cu1+. Uses NAD+ as acceptor |
Reference |
"Six-transmembrane epithelial antigen of the prostate (STEAP1 and STEAP2)-differentially expressed by murine and human mesenchymal stem cells." Vaghjiani R.J., Talma S., Murphy C.L. Tissue Eng Part A 15:2073-2083(2009) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Metalloreductase that has the ability to reduce both Fe(3+) to Fe(2+) and Cu(2+) to Cu(1+). Uses NAD(+) as acceptor (By similarity). |
Subcellular Location |
Endosome membrane, Multi-pass membrane protein, Cell membrane, Multi-pass membrane protein |
Protein Families |
STEAP family |
Tissue Specificity |
Expressed at high levels in prostate and at significantly lower levels in heart, brain, kidney, pancreas, and ovary. |
Tag Information |
N-terminal 10xHis-SUMO-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.