« Zurück
Startseite /
Recombinant Lactococcus lactis subsp.lactis Prolipoprotein diacylglyceryl transferase(lgt)

Recombinant Lactococcus lactis subsp.lactis Prolipoprotein diacylglyceryl transferase(lgt)

ArtNr	CSB-CF875009LNG-10
Hersteller	Cusabio
Menge	10 ug
Quantity options	10 ug 100 ug 20 ug 50 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Konjugat/Tag	HIS
Purity	Greater than 85% as determined by SDS-PAGE.
Sequence	MNNLFPFLALNKIALQLGPLAIHWYAIFIVGGAAL AVWLACKEAPKRNIKTDDIIDFVLFAFPLGIVGAR LYYVIFQWSYYSQHPSQIIAMWDGGGAIYGSLIAG AIVLFVFSYYRMIHPLDLLDITIPGVFLAQAMGRW GNFVNQEAYGKIVSNLDWLPAFIRNQMFIDGHYRM PTFLFESIGTLSGFILVMVFRHRIKGLKRGDIFSF YLVWYGAVRFIVEGMRTDSLMLGPARVSQWLSVLL VIV
Protein Familie	Lgt family
Citations	"The complete genome sequence of the lactic acid bacterium Lactococcus lactis ssp. lactis IL1403." Bolotin A., Wincker P., Mauger S., Jaillon O., Malarme K., Weissenbach J., Ehrlich S.D., Sorokin A. Genome Res. 11:731-753(2001)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Manufacturer - Conjugate / Tag	C-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	32.6 kDa
Relevance	Transfers the N-acyl diglyceride group on what will become the N-terminal cysteine of membrane lipoproteins.
Expression Region	1-261aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Transfers the N-acyl diglyceride group on what will become the N-terminal cysteine of membrane lipoproteins.
Subcellular Location	Cell membrane, Multi-pass membrane protein
Gene Names	lgt
Sequence Info	Full Length
Organism	Lactococcus lactis subsp. lactis (strain IL1403) (Streptococcus lactis)
Storage Buffer	Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-CF875009LNG-10-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10 ug

lieferbar

Lieferung vsl. bis 02.10.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern