« Zurück
Startseite /
Recombinant Human Multidrug resistance-associated protein 1 (ABCC1),partial

Recombinant Human Multidrug resistance-associated protein 1 (ABCC1),partial

ArtNr	CSB-EP001056HU-500
Hersteller	Cusabio
Menge	500 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Oncology Food Safety Hormones Peptides & Proteins Recombinant Proteins By Organ Lung Cancer
Typ	Proteins Recombinant
Specific against	other
Host	E.coli
Konjugat/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	VRMSSEMETNIVAVERLKEYSETEKEAPWQIQETA PPSSWPQVGRVEFRNYCLRYREDLDFVLRHINVTI NGGEKVGIVGRTGAGKSSLTLGLFRINESAEGEII IDGINIAKIGLHDLRFKITIIPQDPVLFSGSLRMN LDPFSQYSDEEVWTSLELAHLKDFVSALPDKLDHE CAEGGENLSVGQRQLVCLARALLRKTKILVLDEAT AAVDLETDDLIQSTIRTQFEDCTVLTIAHRLNTIM DYT
Protein Familie	ABC transporter superfamily, ABCC family, Conjugate transporter (TC 3.A.1.208) subfamily
Citations	"Overexpression of a transporter gene in a multidrug-resistant human lung cancer cell line." Cole S.P.C., Bhardwaj G., Gerlach J.H., Mackie J.E., Grant C.E., Almquist K.C., Stewart A.J., Kurz E.U., Duncan A.M.V., Deeley R.G. Science 258:1650-1654(1992)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	ATP-binding cassette sub-family C member 1,Leukotriene C(4) transporter
Lieferbar
Manufacturer - Targets	ABCC1
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	35.9 kDa
General Research Areas	Signal Transduction
Relevance	Mediates export of organic anions and drugs from the cytoplasm. Mediates ATP-dependent transport of glutathione and glutathione conjugates, leukotriene C4, estradiol-17-beta-o-glucuronide, methotrexate, antiviral drugs and other xenobiotics. Confers resistance to anticancer drugs. Hydrolyzes ATP with low efficiency.
Expression Region	1248-1531aa
Protein Length	Partial
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Mediates export of organic anions and drugs from the cytoplasm. Mediates ATP-dependent transport of glutathione and glutathione conjugates, leukotriene C4, estradiol-17-beta-o-glucuronide, methotrexate, antiviral drugs and other xenobiotics. Confers resistance to anticancer drugs. Hydrolyzes ATP with low efficiency.
Subcellular Location	Cell membrane, Multi-pass membrane protein
Tissue Specificity	Lung, testis and peripheral blood mononuclear cells.
Pathway	Sphingolipidsignalingpathway
Biological activity	Not Test
Manufacturer - Format	Liquid or Lyophilized powder

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP001056HU-500-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 500 ug

lieferbar

Lieferung vsl. bis 30.10.2025

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern