« Zurück
Startseite /
Recombinant Human Aflatoxin B1 aldehyde reductase member 3(AKR7A3)

Recombinant Human Aflatoxin B1 aldehyde reductase member 3(AKR7A3)

ArtNr	CSB-EP001551HU-200
Hersteller	Cusabio
Menge	200 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Food Safety Mycotoxins Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Konjugat/Tag	GST
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MSRQLSRARPATVLGAMEMGRRMDAPTSAAVTRAF LERGHTEIDTAFVYSEGQSETILGGLGLRLGGSDC RVKIDTKAIPLFGNSLKPDSLRFQLETSLKRLQCP RVDLFYLHMPDHSTPVEETLRACHQLHQEGKFVEL GLSNYAAWEVAEICTLCKSNGWILPTVYQGMYNAI TRQVETELFPCLRHFGLRFYAFNPLAGGLLTGKYK YEDKDGKQPVGRFFGNTWAEMYRNRYWKEHHFEGI ALV
Protein Familie	Aldo/keto reductase family, Aldo/keto reductase 2 subfamily
Citations	"cDNA cloning, expression and activity of a second human aflatoxin B1-metabolizing member of the aldo-keto reductase superfamily, AKR7A3." Knight L.P., Primiano T., Groopman J.D., Kensler T.W., Sutter T.R. Carcinogenesis 20:1215-1223(1999)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	AFB1 aldehyde reductase 2
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal GST-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	64.2 kDa
General Research Areas	Signal Transduction
Relevance	Can reduce the dialdehyde protein-binding form of aflatoxin B1 (AFB1) to the non-binding AFB1 dialcohol. May be involved in protection of liver against the toxic and carcinogenic effects of AFB1, a potent hepatocarcinogen.
Expression Region	1-331aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Can reduce the dialdehyde protein-binding form of aflatoxin B1 (AFB1) to the non-binding AFB1 dialcohol. May be involved in protection of liver against the toxic and carcinogenic effects of AFB1, a potent hepatocarcinogen.
Subcellular Location	Cytoplasm
Tissue Specificity	Expressed in colon, kidney, liver, pancreas, adenocarcinoma and endometrium.
Gene Names	AKR7A3
Sequence Info	Full Length of BC025709
Organism	Homo sapiens (Human)
Storage Buffer	Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP001551HU-200-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200 ug

lieferbar

Lieferung vsl. bis 14.08.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern