« Zurück
Startseite /
Recombinant Human Apoptosis regulator Bcl-2(BCL2),partial

Recombinant Human Apoptosis regulator Bcl-2(BCL2),partial

ArtNr	CSB-EP002611HU1-50
Hersteller	Cusabio
Menge	50 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Konjugat/Tag	HIS
Purity	Greater than 85% as determined by SDS-PAGE.
Sequence	AHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVG AAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSP LQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSR RYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDG VNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALW MTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFD
Protein Familie	Bcl-2 family
Citations	"Analysis of the structure, transcripts, and protein products of bcl-2, the gene involved in human follicular lymphoma." Tsujimoto Y., Croce C.M. Proc. Natl. Acad. Sci. U.S.A. 83:5214-5218(1986)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Manufacturer - Conjugate / Tag	C-terminal 10xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	25.2 kDa
Buffer	Tris-based buffer, 50% glycerol
Relevance	Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells. Regulates cell death by controlling the mitochondrial membrane permeability. Appears to function in a feedback loop system with caspases. Inhibits caspase activity either by preventing the release of cytochrome c from the mitochondria and/or by binding to the apoptosis-activating factor (APAF-1). May attenuate inflammation by impairing NLRP1-inflammasome activation, hence CASP1 activation and IL1B release
Expression Region	2-211aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells. Regulates cell death by controlling the mitochondrial membrane permeability. Appears to function in a feedback loop system with caspases. Inhibits caspase activity either by preventing the release of cytochrome c from the mitochondria and/or by binding to the apoptosis-activating factor (APAF-1). May attenuate inflammation by impairing NLRP1-inflammasome activation, hence CASP1 activation and IL1B release
Subcellular Location	Mitochondrion outer membrane, Single-pass membrane protein, Nucleus membrane, Single-pass membrane protein, Endoplasmic reticulum membrane, Single-pass membrane protein
Tissue Specificity	Expressed in a variety of tissues.
Involvement in disease	A chromosomal aberration involving BCL2 has been found in chronic lymphatic leukemia. Translocation t(14; 18)(q32; q21) with immunoglobulin gene regions. BCL2 mutations found in non-Hodgkin lymphomas carrying the chromosomal translocation could be attributed to the Ig somatic hypermutation mechanism resulting in nucleotide transitions.
Pathway	Estrogensignalingpathway
Gene Names	BCL2
Sequence Info	Partial
Organism	Homo sapiens (Human)
Manufacturer - Format	Liquid or Lyophilized powder

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP002611HU1-50-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50 ug

lieferbar

Lieferung vsl. bis 13.11.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern