« Zurück
Startseite /
Recombinant Human F-actin-capping protein subunit beta(CAPZB)

Recombinant Human F-actin-capping protein subunit beta(CAPZB)

ArtNr	CSB-EP004514HU-1
Hersteller	Cusabio
Menge	1 mg
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Host	E.coli
Konjugat/Tag	GST
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MSDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSL CEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDS YRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFD QYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDG SKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVML WLQTNKSGSGTMNLGGSLTRQMEKDETVSDCSPHI ANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRS VQT
Protein Familie	F-actin-capping protein beta subunit family
Citations	Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides. Gevaert K., Goethals M., Martens L., Van Damme J., Staes A., Thomas G.R., Vandekerckhove J. Nat. Biotechnol. 21:566-569(2003)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	CapZ beta
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal GST-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	57.6 kDa
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
General Research Areas	Signal Transduction
Relevance	F-actin-capping proteins bind in a Ca2+-independent manner to the fast growing ends of actin filaments (barbed end) thereby blocking the exchange of subunits at these ends. Unlike other capping proteins (such as gelsolin and severin), these proteins do not sever actin filaments. Plays a role in the regulation of cell morphology and cytoskeletal organization.
Expression Region	1-272aa
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	F-actin-capping proteins bind in a Ca(2+)-independent manner to the fast growing ends of actin filaments (barbed end) thereby blocking the exchange of subunits at these ends. Unlike other capping proteins (such as gelsolin and severin), these proteins do not sever actin filaments. Plays a role in the regulation of cell morphology and cytoskeletal organization.
Subcellular Location	Cytoplasm, cytoskeleton, Cytoplasm, myofibril, sarcomere
Pathway	Endocytosis
Gene Names	CAPZB
Sequence Info	Full Length of Isoform 2
Organism	Homo sapiens (Human)
Manufacturer - Format	Liquid or Lyophilized powder

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP004514HU-1-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1 mg

lieferbar

Lieferung vsl. bis 13.11.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern