« Zurück
Startseite /
Recombinant Tetronarce californica Acetylcholine receptor subunit alpha(CHRNA1),partial

Recombinant Tetronarce californica Acetylcholine receptor subunit alpha(CHRNA1),partial

ArtNr	CSB-EP005386TOT-50
Hersteller	Cusabio
Menge	50 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Konjugat/Tag	HIS
Purity	Greater than 85% as determined by SDS-PAGE.
Sequence	SEHETRLVANLLENYNKVIRPVEHHTHFVDITVGL QLIQLISVDEVNQIVETNVRLRQQWIDVRLRWNPA DYGGIKKIRLPSDDVWLPDLVLYNNADGDFAIVHM TKLLLDYTGKIMWTPPAIFKSYCEIIVTHFPFDQQ NCTMKLGIWTYDGTKVSISPESDRPDLSTFMESGE WVMKDYRGWKHWVYYTCCPDTPYLDITYHFIMQRI
Protein Familie	Ligand-gated ion channel (TC 1.A.9) family, Acetylcholine receptor (TC 1.A.9.1) subfamily, Alpha-1/CHRNA1 sub-subfamily
Citations	"Proteolytic fragments of the nicotinic acetylcholine receptor identified by mass spectrometry: implications for receptor topography." Moore C.R., Yates J.R. III, Griffin P.R., Shabanowitz J., Martino P.A., Hunt D.F., Cafiso D.S. Biochemistry 28:9184-9191(1989)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	28.8 kDa
General Research Areas	Neuroscience
Relevance	After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.
Expression Region	25-234aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.
Subcellular Location	Cell junction, synapse, postsynaptic cell membrane, Multi-pass membrane protein, Cell membrane, Multi-pass membrane protein
Gene Names	CHRNA1
Sequence Info	Partial
Organism	Torpedo californica (Pacific electric ray)
Storage Buffer	Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP005386TOT-50-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50 ug

lieferbar

Lieferung vsl. bis 02.10.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern