« Zurück
Startseite /
Recombinant Mouse 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial(Cyp27b1)

Recombinant Mouse 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial(Cyp27b1)

ArtNr	CSB-EP006406MO-50
Hersteller	Cusabio
Menge	50 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Konjugat/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MTQAVKLASRVFHRIHLPLQLDASLGSRGSESVLR SLSDIPGPSTLSFLAELFCKGGLSRLHELQVHGAA RYGPIWSGSFGTLRTVYVADPTLVEQLLRQESHCP ERCSFSSWAEHRRRHQRACGLLTADGEEWQRLRSL LAPLLLRPQAAAGYAGTLDNVVRDLVRRLRRQRGR GSGLPGLVLDVAGEFYKFGLESIGAVLLGSRLGCL EAEVPPDTETFIHAVGSVFVSTLLTMAMPNWLHHL IPG
Protein Familie	Cytochrome P450 family
Citations	"25-hydroxyvitamin D 1alpha-hydroxylase: structure of the mouse gene, chromosomal assignment, and developmental expression." Panda D.K., Al-Kawas S., Seldin M.F., Hendy G.N., Goltzman D. J. Bone Miner. Res. 16:46-56(2001)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	25-OHD-1 alpha-hydroxylase,25-hydroxyvitamin D(3) 1-alpha-hydroxylase
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	60.2 kDa
Buffer	Tris-based buffer, 50% glycerol
Relevance	Catalyzes the conversion of 25-hydroxyvitamin D3 (25(OH)D3) to 1-alpha, 25-dihydroxyvitamin D3 (1alpha, 25(OH)2D3), and of 24, 25-dihydroxyvitamin D3 (24, 25(OH)2D3) to 1-alpha, 24, 25-trihydroxyvitamin D3 (1alpha, 24, 25(OH)3D3). Is also active with 25-hydroxy-24-oxo-vitamin D3. Plays an important role in normal bone growth, calcium metabolism, and tissue differentiation.
Expression Region	1-507aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Catalyzes the conversion of 25-hydroxyvitamin D3 (25(OH)D3) to 1-alpha, 25-dihydroxyvitamin D3 (1alpha, 25(OH)(2)D3), and of 24, 25-dihydroxyvitamin D3 (24, 25(OH)(2)D3) to 1-alpha, 24, 25-trihydroxyvitamin D3 (1alpha, 24, 25(OH)(3)D3). Is also active with 25-hydroxy-24-oxo-vitamin D3. Plays an important role in normal bone growth, calcium metabolism, and tissue differentiation.
Subcellular Location	Mitochondrion membrane
Tissue Specificity	Kidney.
Gene Names	Cyp27b1
Sequence Info	Full Length
Organism	Mus musculus (Mouse)
Manufacturer - Format	Liquid or Lyophilized powder

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP006406MO-50-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50 ug

lieferbar

Lieferung vsl. bis 23.10.2025